| PDBID: | 8ztz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-07 | | Release date: | 2025-06-07 |
|
| PDBID: | 8zts | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8ztu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8ztt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c5y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c60 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c5z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c6d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mutant NonPro1 Tautomerase Superfamily Member 8U6-S1P in complex with 3-bromopropiolate inhibitor | | Authors: | Hardtke, H.A., Venkat Ramani, M.K., Zhang, Y.J. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c63 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c64 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c65 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 | | Sequence: | >Entity 1
STLEVRSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREGSGRQADNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
|
|
| PDBID: | 9c6o | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Multiple independent acquisitions of ACE2 usage in MERS-related coronaviruses | | Authors: | Park, Y.J., Seattle Structural Genomics Center for Infectious Diseases, Veesler, D., Seattle Structural Genomics Center for Infectious Disease (SSGCID) | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c6b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c6h | | Status: | HPUB -- hold until publication | | Title: | [d3] Tensegrity triangle with deazapurine center strand (strand 3) in R3 | | Authors: | Vecchioni, S., Sha, R., Ohayon, Y., Galindo, M., Lopez-Chamorro, C., Jong, M. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c6i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c6j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c6e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c6k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c6g | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Mcm double hexamer from human | | Authors: | Liu, C., Xu, N., Lin, Q. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8zt6 | | Status: | HPUB -- hold until publication | | Title: | structure of ligand-bound FBP1 protein | | Authors: | Wang, W.H., Zhang, J.Z., Yang, M.J. | | Deposition date: | 2024-06-06 |
|
| PDBID: | 8zt5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-06 | | Release date: | 2025-06-06 |
|
| PDBID: | 8zt7 | | Status: | HPUB -- hold until publication | | Title: | structure of FBP1 in apo state | | Authors: | Wang, W.H., Zhang, J.Z., Yang, M.J. | | Deposition date: | 2024-06-06 |
|
| PDBID: | 8zt8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of calcium preference channel P2X1 | | Authors: | Zhang, H., Xu, H.E. | | Deposition date: | 2024-06-06 | | Release date: | 2025-06-06 |
|
| PDBID: | 8zta | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-06 | | Release date: | 2025-06-06 |
|
| PDBID: | 8zt1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-06 | | Release date: | 2025-06-06 |
|
