| PDBID: | 9fyj | | Status: | HPUB -- hold until publication | | Title: | N-terminal domain of human galectin-8 in complex with an alpha-galactoside ligand | | Authors: | Adrover Forteza, J., Puric, E., Nilsson, U.J., Anderluh, M., Logan, D.T. | | Deposition date: | 2024-07-03 | | Sequence: | >Entity 1
SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSD
|
|
| PDBID: | 9fyh | | Status: | HOLD -- hold until a certain date | | Title: | Dye Type Peroxidase Aa from Streptomyces lividans by microcrystal electron diffraction (MicroED/3D ED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Finjallaz, A., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2024-07-03 | | Release date: | 2025-07-03 |
|
| PDBID: | 9fyk | | Status: | HPUB -- hold until publication | | Title: | Dye Type Peroxidase Aa from Streptomyces lividans by serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Finjallaz, A., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9ime | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9imf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of di-NMPylated HEPN family toxin | | Authors: | Wang, X.X., Chen, R., Yao, J.Y. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9imi | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of UGT94BY1 in complex with UDP | | Authors: | Jiang, Z., Yuan, Y. | | Deposition date: | 2024-07-03 | | Release date: | 2025-07-03 |
|
| PDBID: | 9imn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a TEF30-associated intermediate PSII core dimer complex, type I, from Chlamydomonas reinhardtii | | Authors: | Wang, Y., Wang, C., Li, A., Liu, Z. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9imk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural basis for concurrence of template recycling and RNA capping in SARS-CoV-2 replication/transcription | | Authors: | Yan, L.M., Rao, Z.H., Lou, Z.Y. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9iml | | Status: | HPUB -- hold until publication | | Title: | Sertraline enhances the deubiquitinase activity of USP7 by binding to its switching loop region | | Authors: | Shi, L., Xu, Z., Chen, X., Xiong, B., Zhang, N. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9imm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural basis for concurrence of template recycling and RNA capping in SARS-CoV-2 replication/transcription | | Authors: | Yan, L.M., Rao, Z.H., Lou, Z.Y. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9cig | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9cif | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9cie | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9cid | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9cin | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab fragment of Antibody with NiV glycoprotein F | | Authors: | Ouizougun-Oubari, M., Bajic, G. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9cim | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9cic | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9cib | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fxv | | Status: | HPUB -- hold until publication | | Title: | Influenza polymerase A C-terminal domain of PA subunit with peptide inhibitor containing two norleucines | | Authors: | Radilova, K., Brynda, J. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9fxx | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Influenza polymerase A C-terminal domain of PA subunit with stapled peptide inhibitor | | Authors: | Radilova, K., Brynda, J. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9fy2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9fy3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9fxo | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME WITH A/P/E-SITE TRNA AND MRNA : LM32CS1C1 M2 OE MUTANT | | Authors: | Rajan, K.S., Yonath, A. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9fxy | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of Autotaxin (ENPP2) with Type IV Inhibitor | | Authors: | Borza, R., Joosten, R.P., Perrakis, A. | | Deposition date: | 2024-07-02 |
|
