PDBID: | 9esm | Status: | HPUB -- hold until publication | Title: | Archaellum filament from the Halobacterium salinarum deltaAgl26 strain | Authors: | Grosmann-Haham, I., Shahar, A. | Deposition date: | 2024-03-26 |
|
PDBID: | 9eth | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9etj | Status: | HOLD -- hold until a certain date | Title: | Mouse CNPase catalytic domain with nanobody 10E | Authors: | Markusson, S., Raasakka, A., Opazo, F., Kursula, P. | Deposition date: | 2024-03-26 | Release date: | 2025-03-26 |
|
PDBID: | 9ett | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9esa | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9etk | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9etl | Status: | HOLD -- hold until a certain date | Title: | Mouse CNPase catalytic domain with nanobody 8D | Authors: | Schroder, M., Markusson, S., Raasakka, A., Opazo, F., Kursula, P. | Deposition date: | 2024-03-26 | Release date: | 2025-03-26 |
|
PDBID: | 9eto | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9etr | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9etq | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9ets | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9esd | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9esf | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9esi | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9esg | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9et0 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | CDK2-cyclin A in complex with FragLite 13 | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | Deposition date: | 2024-03-26 |
|
PDBID: | 9esv | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | CDK2-cyclin A in complex with FragLite 19 | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | Deposition date: | 2024-03-26 |
|
PDBID: | 9eti | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9etm | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9etc | Status: | HPUB -- hold until publication | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with chenodeoxycholic acid | Authors: | Tassone, G., Pozzi, C. | Deposition date: | 2024-03-26 | Sequence: | >Entity 1 GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
PDBID: | 8yu1 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-03-26 | Release date: | 2025-03-26 |
|
PDBID: | 8ytk | Status: | HPUB -- hold until publication | Title: | Crystal structure of human prolyl-tRNA synthetase in complex with inhibitor | Authors: | Luo, Z., Zhou, H. | Deposition date: | 2024-03-26 |
|
PDBID: | 8ytt | Status: | HPUB -- hold until publication | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | Deposition date: | 2024-03-26 |
|
PDBID: | 8ytj | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of enterovirus A71 mature virion | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | Deposition date: | 2024-03-26 |
|
PDBID: | 8ytm | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of actinomycin D and Echinomycin-d(ACGATGCT/AGCACGT) complex | Authors: | Wu, Y.S., Lee, Y.Y., Hou, M.H. | Deposition date: | 2024-03-26 |
|