| PDBID: | 9lu3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9lu5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of bacteriophage T4 neck protein gp13 and gp14 and Hfq assembled in vitro in C6 symmetry | | Authors: | Han, L., Mao, Q., Sun, L. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9lu6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of bacteriophage T4 protal-neck protein gp20-gp13-gp14-Hfq assembled in vitro in C6 symmetry | | Authors: | Han, L., Mao, Q., Sun, L. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9lu7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of bacteriophage T4 protal-neck mismatch complex gp20-gp14-gp13 assembled in vitro in C6 symmetry | | Authors: | Han, L., Mao, Q., Sun, L. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9lu0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9lu2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9ltz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9lu1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9lu4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9lty | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-07 | | Release date: | 2026-02-07 |
|
| PDBID: | 9n7q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human anti-Pfs48/45 transmission-blocking antibody RUPA-71 | | Authors: | Hailemariam, S., Ivanochko, D., Julien, J.P. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7n | | Status: | HPUB -- hold until publication | | Title: | Glutarate L-2-hydroxylase Q184C mutant-5''-Mal-C6-AGCT DNA conjugate at 1.82 Angstrom resolution | | Authors: | Han, Z., Mirkin, C.A. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7m | | Status: | HPUB -- hold until publication | | Title: | Designed anti-OSM Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Hofmann, J.L., Watkins, A.M., Seeger, F., Dou, Y., Zhang, X. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7o | | Status: | HPUB -- hold until publication | | Title: | Designed anti-OSM Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Hofmann, J.L., Watkins, A.M., Seeger, F., Dou, Y., Zhang, X. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7u | | Status: | HPUB -- hold until publication | | Title: | Glutarate L-2-hydroxylase Q184C mutant-5''-Mal-C2-AGCT DNA conjugate at 2.17 Angstrom resolution | | Authors: | Han, Z., Mirkin, C.A. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7w | | Status: | HPUB -- hold until publication | | Title: | antibody 5E10 Fab | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2025-02-06 | | Sequence: | >Entity 1
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTFKLLIYYTSRLHSGVPSRFSGGGSGTDYSLTISNLEKEDIATYFCQQGNTLPRTFGGGTRLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>Entity 2
(PCA)VQLLQPGAELVRPGASVRLSCKTSGYTFTSYWINWVKQRPGQGLEWIGKIFPSDSHTNYNQKFKDKATLTVDKSSSTAYMQLISPTSEDSAVYYCTRDFDTQFYAMEYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
|
|
| PDBID: | 9n7x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i91 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i9l | | Status: | HPUB -- hold until publication | | Title: | Structure of Far-Red Photosystem I from C. thermalis PCC 7203 | | Authors: | Consoli, G., Tufaill, F., Murray, J.W., Fantuzzi, A., Rutherford, A.W. | | Deposition date: | 2025-02-06 |
|
