| PDBID: | 9mze | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of GLP-1R-Gs complex with oxyntomodulin | | Authors: | Zhang, X., Belousoff, M.J., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9mz5 | | Status: | HPUB -- hold until publication | | Title: | EatA-EatI complex from Mycobacterium avium subsp. paratuberculosis | | Authors: | Benedict, S.T., Moynihan, P.J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9mzc | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R. | | Deposition date: | 2025-01-22 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGRSMKLSCAASGFIFSNYGMAWVRQAPKKGLEWVAYINYDGGTTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTTGYYYDGSYYYDRFVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
>Entity 2
DIQMTQSPSFLSASEGERVTLNCRASQNINKYLDWYQQKLGEAPKLLIYNTNNLHTGIPSRFSGSGSGTDYTITISSLQPEDVATYFCLQRNSWYTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
| PDBID: | 9mxy | | Status: | HPUB -- hold until publication | | Title: | Pseudomonas fluorescens isocyanide hydratase D17N mutant, pH=6.5 | | Authors: | Smith, N., Prososki, K., Wilson, M.A. | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9myk | | Status: | HPUB -- hold until publication | | Title: | A domain-swapped structure of QEVKG mutant of Monellin | | Authors: | Manjula, R., Subramanian, R., Gosavi, S. | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9myc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9myd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9myh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9my0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9my3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9myi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9mye | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9my8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9my1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9my4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9i2m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9i2n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9i2p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Listeria monocytogenes ChiA | | Authors: | Rehman, S., Garnett, J.A. | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9lno | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9lnn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9lnm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9ln9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9lnj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9lnk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9lne | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-21 |
|
