| PDBID: | 9iax | | Status: | HPUB -- hold until publication | | Title: | DNA-PK, LX4, XLF - Catalytic domain of L4 | | Authors: | Chaplin, A.K., Hall, C. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iau | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iav | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ib6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of H1 Haemagglutinin HN/18 from Influenza A virus | | Authors: | Deng, G., Wei, X., Sun, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mutant H1 Haemagglutinin HN/18-HA FPP from Influenza A virus | | Authors: | Deng, G., Wei, X., Sun, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of H1 Haemagglutinin HN/18-HA2-L113S from Influenza A virus | | Authors: | Deng, G., Wei, X., Sun, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-11 | | Release date: | 2026-02-11 |
|
| PDBID: | 9lv4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9q | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9o | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9w | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of AMPPNP bound human phosphoribosylformylglycinamidine synthase | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRAS(G12C) bound to the cyclic peptide UNC10415730A | | Authors: | Rossman, K.L. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na1 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9nad | | Status: | HPUB -- hold until publication | | Title: | Human GSTO1-1 complexed with C5-1 | | Authors: | Oakley, A.J. | | Deposition date: | 2025-02-11 | | Sequence: | >Entity 1
SGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
|
|
| PDBID: | 9na7 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iaf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9iae | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
