Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
Status search: 15031 results
PDBID:9lz0
Status:HPUB -- hold until publication
Deposition date:2025-02-21
PDBID:9lz1
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-02-21
PDBID:9lz3
Status:HPUB -- hold until publication
Title:Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 100-ms time delay
Authors:Murakawa, T., Okajima, T.
Deposition date:2025-02-21
PDBID:9lz4
Status:HPUB -- hold until publication
Title:Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 200-ms time delay
Authors:Murakawa, T., Okajima, T.
Deposition date:2025-02-21
PDBID:9lz5
Status:HPUB -- hold until publication
Title:Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 300-ms time delay
Authors:Murakawa, T., Okajima, T.
Deposition date:2025-02-21
PDBID:9lz6
Status:HPUB -- hold until publication
Title:Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 400-ms time delay
Authors:Murakawa, T., Okajima, T.
Deposition date:2025-02-21
PDBID:9lz8
Status:HPUB -- hold until publication
Title:Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 22-ms time delay
Authors:Murakawa, T., Okajima, T.
Deposition date:2025-02-21
PDBID:9lz9
Status:HPUB -- hold until publication
Title:Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 25-ms time delay
Authors:Murakawa, T., Okajima, T.
Deposition date:2025-02-21
PDBID:9lza
Status:HPUB -- hold until publication
Title:Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 25-ms time delay
Authors:Murakawa, T., Okajima, T.
Deposition date:2025-02-21
PDBID:9lzb
Status:HPUB -- hold until publication
Title:Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 50-ms time delay
Authors:Murakawa, T., Okajima, T.
Deposition date:2025-02-21
PDBID:9lzc
Status:HPUB -- hold until publication
Title:Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 50-ms time delay
Authors:Murakawa, T., Okajima, T.
Deposition date:2025-02-21
PDBID:9lzd
Status:HPUB -- hold until publication
Title:Oxidative form of copper amine oxidase from Arthrobacter globiformis determined at pH 9.0 by single-flow serial crystallography
Authors:Murakawa, T., Okajima, T.
Deposition date:2025-02-21
PDBID:9lze
Status:HPUB -- hold until publication
Title:Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 500-ms time delay
Authors:Murakawa, T., Okajima, T.
Deposition date:2025-02-21
PDBID:9lzf
Status:HPUB -- hold until publication
Title:Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 1000-ms time delay
Authors:Murakawa, T., Okajima, T.
Deposition date:2025-02-21
PDBID:9lyt
Status:HPUB -- hold until publication
Title:The crystal structure of Mucuna sempervirens Pathogenesis-related protein 1
Authors:Zha, H.G., Fan, S.L.
Deposition date:2025-02-21
PDBID:9lyv
Status:HPUB -- hold until publication
Title:structure of prrx bound to DNA
Authors:Dong, C., Yan, X.J., Guo, S.M., Huang, Y.L.
Deposition date:2025-02-21
PDBID:9lyu
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica (Ligand-free form)
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-21
PDBID:9lyx
Status:AUTH -- processed, waiting for author review and approval
Title:hCTPS1 with CTP and DON
Authors:Guo, C.J., Bao, X.J., Liu, J.L.
Deposition date:2025-02-21
PDBID:9lyy
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica complexed with ADP and G3P.
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-21
PDBID:9lzg
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica complexed with daphnetin.
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-21
PDBID:9lzi
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica complexed with GK-butyl.
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-21
PDBID:9lz7
Status:HPUB -- hold until publication
Title:Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 22-ms time delay
Authors:Murakawa, T., Okajima, T.
Deposition date:2025-02-21
Sequence:

>Entity 1


ASPFRLASAGEISEVQGILRTAGLLGPEKRIAYLGVLDPARGAGSEAEDRRFRVFIHDVSGARPQEVTVSVTNGTVISAVELDTAATGELPVLEEEFEVVEQLLATDERWLKALAARNLDVSKVRVAPLSAGVFEYAEERGRRILRGLAFVQDFPEDSAWAHPVDGLVAYVDVVSKEVTRVIDTGVFPVPAEHGNYTDPELTGPLRTTQKPISITQPEGPSFTVTGGNHIEWEKWSLDVGFDVREGVVLHNIAFRDGDRLRPIINRASIAEMVVPYGDPSPIRSWQNYFDTGEYLVGQYANSLELGCDCLGDITYLSPVISDAFGNPREIRNGICMHEEDWGILAKHSDLWSGINYTRRNRRMVISFFTTIGN(2TY)DYGFYWYLYLDGTIEFEAKATGVVFTSAFPEGGSDNISQLAPGLGAPFHQHIFSARLDMAIDGFTNRVEEEDVVRQTMGPGNERGNAFSRKRTVLTRESEAVREADARTGRTWIISNPESKNRLNEPVGYKLHAHNQPTLLADPGSSIARRAAFATKDLWVTRYADDERYPTGDFVNQHSGGAGLPSYIAQDRDIDGQDIVVWHTFGLTHFPRVEDWPIMPVDTVGFKLRPEGFFDRSPVLDVPAN
PDBID:9lz2
Status:HPUB -- hold until publication
Deposition date:2025-02-21
PDBID:9net
Status:HPUB -- hold until publication
Deposition date:2025-02-20
PDBID:9nem
Status:HPUB -- hold until publication
Deposition date:2025-02-20

238582

건을2025-07-09부터공개중

PDB statisticsPDBj update infoContact PDBjnumon