| PDBID: | 8xtt | | Status: | HOLD -- hold until a certain date | | Title: | Nuclear receptor Nor1 ligand binding domain | | Authors: | Yoo, J.Y., Yoon, H.S. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
KSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
|
|
| PDBID: | 8xto | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment L18-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
LGGGSVRFGPGVAFRAPSIHG
|
|
| PDBID: | 8rni | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rns | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase XII mimic in complex with biguanide derivative inhibitor 1-carbamimidamido-N-[(4 sulfamoylphenyl)methyl]methanimidamide | | Authors: | Baroni, C., Ferraroni, M. | | Deposition date: | 2024-01-10 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8vky | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8vkx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8vkv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8vkw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt7 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of human AS3MT | | Authors: | Chun, I.S., Kim, M.S. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xtc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xsw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-10 | | Release date: | 2025-07-10 |
|
| PDBID: | 8xt8 | | Status: | HPUB -- hold until publication | | Title: | Clostridioides difficile MarR (WP_003434724) with Hg-bound | | Authors: | Park, S., Kwon, N. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xta | | Status: | HPUB -- hold until publication | | Title: | Clostridioides difficile MarR (WP_003434724) | | Authors: | Park, S., Kwon, N. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt9 | | Status: | HPUB -- hold until publication | | Title: | structure of LGR4 | | Authors: | Wang, L., Geng, Y. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xtb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xtd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xsu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rmx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rmy | | Status: | HPUB -- hold until publication | | Title: | Transglutaminase 3 in complex with inhibitor Z-don and DH patient-derived Fab DH63-A02 | | Authors: | Heggelund, J.E., Sollid, L.M. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rne | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rnf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rmz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8vks | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
