| PDBID: | 8kbp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8tox | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
| PDBID: | 8toz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
| PDBID: | 8toy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8q2z | | Status: | HPUB -- hold until publication | | Title: | HsNMT1 in complex with both MyrCoA and GNLLSKFR peptide | | Authors: | Dian, C., Giglione, C., Meinnel, T. | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8kb3 | | Status: | HPUB -- hold until publication | | Title: | Superoxide dismutase | | Authors: | Zhai, L., Li, B.Q., Jia, H.H. | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8kap | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-03 | | Release date: | 2024-08-03 |
|
| PDBID: | 8kaq | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-03 | | Release date: | 2024-08-03 |
|
| PDBID: | 8kao | | Status: | HPUB -- hold until publication | | Title: | Glutamate dehydrogenase-69O | | Authors: | Sakuraba, H., Ohshima, T. | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8kar | | Status: | HPUB -- hold until publication | | Title: | Glutamate dehydrogenase-AKG | | Authors: | Sakuraba, H., Ohshima, T. | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8ton | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-03 | | Release date: | 2024-08-03 |
|
| PDBID: | 8toh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8to9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8tog | | Status: | HPUB -- hold until publication | | Title: | X-Ray Structure Determination of Dihydromethanopterin Reductase (DmrA) from Methylobacterium extorquens AM1 in a P6522 Space Group at a Resolution of 1.56 Angstroms | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbing, M., Collazo, M.J., Potla, S. | | Deposition date: | 2023-08-03 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8to7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8top | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of HIV-1 Env BG505 DS-SOSIP in complex with antibody GPZ6-b.01 targeting the fusion peptide | | Authors: | Zhou, T., Morano, N.C., Roark, R.S., Kwong, P.D. | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8ka9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-02 | | Release date: | 2024-08-02 |
|
| PDBID: | 8q2f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-02 | | Release date: | 2025-02-07 |
|
| PDBID: | 8q2h | | Status: | HPUB -- hold until publication | | Title: | beta-galactosidase from Bacillus circulans | | Authors: | Kascakova, B., Hovorkova, M., Petraskova, L., Novacek, J., Pinkas, D., Gardian, Z., Kren, V., Bojarova, P., Kuta Smatanova, I. | | Deposition date: | 2023-08-02 |
|
| PDBID: | 8q2n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-02 |
|
| PDBID: | 8ka7 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NB7 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-02 |
|
| PDBID: | 8kac | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NX1 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-02 |
|
| PDBID: | 8ka6 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NA7 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-02 |
|
