| PDBID: | 8wcu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Bacterial ferritin mutant-E4FY | | Authors: | Zhao, G., Zeng, R. | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8wcf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of EcThsB | | Authors: | Chen, Q., Yu, Y. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8wcg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-1 RBD in complex with nanobody aSR29 and aSR347 | | Authors: | Zeng, W.H., Ma, H., Jin, T.C. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qiz | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of Paradendryphiella salina PL7C alginate lyase mutant H124 soaked with with penta-mannuronic acid | | Authors: | Wilkens, C. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Levansucrase beta from Pseudomonas syringae pv. actinidiae | | Authors: | Ferraroni, M., Peritore, L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qie | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME : LM32Cs1C1 mutant snoRNA overexpression, class 4 | | Authors: | Rajan, K.S., Yonath, A., Bashan, A. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cytochrome domain 1 from PgcA | | Authors: | Nash, B.W., Edwards, M.J., Clarke, T.A. | | Deposition date: | 2023-09-12 | | Release date: | 2024-12-12 |
|
| PDBID: | 8qj1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-12 | | Release date: | 2024-09-12 |
|
| PDBID: | 8qj2 | | Status: | HPUB -- hold until publication | | Title: | Structure of active state MC4R in complex with a potent ligand mimicking nanobody | | Authors: | Busch, A., Jaakola, V.-P., Masiulis, S. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u59 | | Status: | HPUB -- hold until publication | | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-12 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8u56 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u58 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5c | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u54 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5l | | Status: | HPUB -- hold until publication | | Title: | MAU868, a novel human-derived monoclonal neutralizing antibody targeting BK virus VP1 | | Authors: | Knapp, M.S., Ornelas, E. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of human IDO1 bound to Compound 23 | | Authors: | Steinbacher, S., Lammens, A., Harris, S.F. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5o | | Status: | HPUB -- hold until publication | | Title: | The structure of the catalytic domain of NanI sialdase in complex with Neu5Gc | | Authors: | Medley, B.J., Low, K.E., Garber, J.M., Gray, T.E., Liu, L., Klassen, L., Fordwour, O.B., Inglis, G.D., Boons, G.J., Zandberg, W.F., Abbott, W.D., Boraston, A.B. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8wci | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8wck | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | FCP tetramer in Chaetoceros gracilis | | Authors: | Feng, Y., Li, Z., Zhou, C., Shen, J.-R., Liu, C., Wang, W. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8wcl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | FCP pentamer in Chaetoceros gracilis | | Authors: | Feng, Y., Li, Z., Zhou, C., Liu, C., Shen, J.-R., Wang, W. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8wcj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GB3 penta mutation L5V/K10H/T16S/K19E/Y33I | | Authors: | Qin, M.M., Chen, X.X., Zhang, X.Y., Song, X.F., Yao, L.S. | | Deposition date: | 2023-09-12 |
|
