| PDBID: | 8vlo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vlp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vla | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vl2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vl5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtt | | Status: | HOLD -- hold until a certain date | | Title: | Nuclear receptor Nor1 ligand binding domain | | Authors: | Yoo, J.Y., Yoon, H.S. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
KSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
|
|
| PDBID: | 8xto | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment L18-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
LGGGSVRFGPGVAFRAPSIHG
|
|
| PDBID: | 8xtn | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment Y6-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
YRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHG
|
|
| PDBID: | 8xtu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Rab5b GTPase domain from Leishmania donovani in complex with GDP | | Authors: | Zohib, M., Pal, R.K., Biswal, B.K., Arora, A. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtq | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron 2 | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Shang, S.T., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtp | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron 4 | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Shang, S.T., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xts | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Shang, S.T., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AaHPPD-Y14150 complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xta | | Status: | HPUB -- hold until publication | | Title: | Clostridioides difficile MarR (WP_003434724) | | Authors: | Park, S., Kwon, N. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt9 | | Status: | HPUB -- hold until publication | | Title: | structure of LGR4 | | Authors: | Wang, L., Geng, Y. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xtb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xtd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnk | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with myristic acid | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rno | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with isophorone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnn | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with prednisone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnq | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with dodecane | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnm | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with testosterone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnr | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with tetradecane | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnp | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with R-limonene | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
