| PDBID: | 8xzz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8y01 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Medium-wave-sensitive opsin 1 | | Authors: | Peng, Q., Jiang, H.H., Cheng, X.Y., Li, J., Zhang, J. | | Deposition date: | 2024-01-21 | | Release date: | 2025-01-21 |
|
| PDBID: | 8y02 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Short-wave-sensitive opsin 1 | | Authors: | Peng, Q., Jiang, H.H., Cheng, X.Y., Li, J., Zhang, J. | | Deposition date: | 2024-01-21 | | Release date: | 2025-01-21 |
|
| PDBID: | 8xzv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xza | | Status: | HPUB -- hold until publication | | Title: | BA.2.86 Spike in complex with bovine ACE2 (Local refinement) | | Authors: | Yue, C., Liu, P. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xz9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BA.2.86 Spike in complex with bovine ACE2 (bound 2 ACE2) | | Authors: | Yue, C., Liu, P. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8y00 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xz8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BA.2.86 Spike in complex with bovine ACE2 (bound 1 ACE2) | | Authors: | Yue, C., Liu, P. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8rqy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MakC from the mak operon of Vibrio cholerae | | Authors: | Bodra, N., Persson, K. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8vrc | | Status: | HPUB -- hold until publication | | Title: | Tetrahymena thermophila MLP1 RRM domain | | Authors: | Donaldson, L.W. | | Deposition date: | 2024-01-21 | | Sequence: | >Entity 1
TFQPIIFSTACEQEGVANWRNITEALLKQHNVHAPYCRFGKLEGNFALNKDKTSQEVIDQLVQDGLQFGESKVTIKVSEGEALSKFWELHGRHYNGVMEL
|
|
| PDBID: | 8vrf | | Status: | HPUB -- hold until publication | | Title: | Sucrose-phosphate synthase-like protein from Leishmania major | | Authors: | Gorman, M.A., Parker, M.W., McConville, M.J. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xyv | | Status: | HPUB -- hold until publication | | Title: | De novo designed protein 0705-5 | | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xyr | | Status: | HPUB -- hold until publication | | Title: | De novo designed protein GPX4-2 | | Authors: | Liu, L.J., Guo, Z., Lai, L.H. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xys | | Status: | HPUB -- hold until publication | | Title: | De novo designed protein GPX4-1 | | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xyt | | Status: | HPUB -- hold until publication | | Title: | De novo designed protein GPX4-4 | | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xyu | | Status: | HPUB -- hold until publication | | Title: | De novo designed protein GPX4-3 | | Authors: | Guo, Z., Liu, J.L., Lai, L.H. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xyw | | Status: | HPUB -- hold until publication | | Title: | De novo designed protein Trx-3 | | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xz3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xym | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CX1 spike protein (6P) | | Authors: | Xu, Z.P., Li, L.J., Gu, Y.H., Qi, J.X., Gao, G.F. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xyp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xyo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CX1 receptor binding domain in complex with human ACE2 | | Authors: | Xu, Z.P., Li, L.J., Gu, Y.H., Qi, J.X., Gao, G.F. | | Deposition date: | 2024-01-20 |
|
