| PDBID: | 9glh | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of UFC1 T106S | | Authors: | Kumar, M., Banerjee, S., Wiener, R. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gli | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gll | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glm | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of UFC1 W145F | | Authors: | Kumar, M., Banerjee, S., Wiener, R. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gln | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glf | | Status: | HOLD -- hold until a certain date | | Title: | Anthraquinone Pigment Production Regulated by Cinnamic Acid | | Authors: | Su, L., Schmalhofer, M., Grammbitter, G.L.C., Paczia, N., Glatter, T., Groll, M., Bode, H.B. | | Deposition date: | 2024-08-27 | | Release date: | 2025-08-27 | | Sequence: | >Entity 1
GSSHHHHHHSGDPASMNNKNKPNRISPELLATCGYFMPRIFFLNSQYAPQVHWGDVVAALSHFPAGNLDLSSEEFWYEWMINWSKVGDSYINIANSAKSEVSHVRALRSAAACYHWAEFMYFSDRSRKIQLREYIRSCFLSSIKYSDLLVDHQYIVVDKFHMPFFLIFPKGYKEEENHPLPCVILSNGLDSMTEIEILSLAEFFLGKNMAVAIFDGPGQGINLGKSPIAIDMELYVSSIVKLLEDDARINSNLLCFLGISFGGYFALRVAQRIGDKFCCIVNLSGGPEIAEFDKLPRRLKEDFQFAFMQDNSHMQSIFDEIKLDISLPCKTKVFTVHGELDDIFQIDKVKKLDQLWGDNHQLLCYESEAHVCLNKINEYMIQVSDWVSEQFWLNGYKKG
|
|
| PDBID: | 9gl5 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the Thermus thermophilus Q190E mutant of the PilF-GSPIIB domain in the c-di-GMP bound state | | Authors: | Neissner, K., Woehnert, J. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glg | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the Thermus thermophilus Q218E mutant of the PilF-GSPIIB domain in the c-di-GMP bound state | | Authors: | Neissner, K., Woehnert, J. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gld | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of p73 tetramerisation domain in complex with darpins 1800 | | Authors: | Chaikuad, A., Strubel, A., Doetsch, V., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The cryo-EM structure of Ac-K58D_G51DA53T a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9dct | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9dcs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9dcr | | Status: | HPUB -- hold until publication | | Title: | Structure of the TelA-associated type VII secretion system chaperone SIR_0168 | | Authors: | Gkragkopoulou, P., Kim, Y., Whitney, J.C. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9ddb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of gB-Ecto.516P.531E, a prefusion-stabilized HSV-1 glycoprotein B extracellular domain | | Authors: | Roark, R.S., Shapiro, L., Kwong, P.D. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9dda | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9dd9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9dcx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9dcy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9dcz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9dd0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
