PDBID: | 8w8v | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 | Release date: | 2025-03-05 |
|
PDBID: | 8w8u | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-09-04 | Release date: | 2025-03-05 |
|
PDBID: | 8w97 | Status: | HPUB -- hold until publication | Title: | De novo design protein -PK16 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w92 | Status: | HPUB -- hold until publication | Title: | human H ferritin with 2 Fe(II)/subunit loading | Authors: | Zhang, T., Jiao, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w94 | Status: | HPUB -- hold until publication | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE exposed to H2O2 for 2 s | Authors: | Zhang, T., Jiao, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8qf6 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-03 |
|
PDBID: | 8w8i | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-02 | Sequence: | >Entity 1 MKKLLIAAGSVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIALHHHHHH
>Entity 2 MKKLLIAAGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMYWVRQAPGKGLEWVSKINTNGLITKYPDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCARSPSGFNRGQGTLVTVSSHHHHHH
|
|
PDBID: | 8qf0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-01 |
|
PDBID: | 8qep | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-01 | Release date: | 2025-03-01 |
|
PDBID: | 8qeq | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-01 |
|
PDBID: | 8qew | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-01 |
|
PDBID: | 8u1h | Status: | HPUB -- hold until publication | Title: | Axle-less Bacillus sp. PS3 F1 ATPase mutant | Authors: | Furlong, E.J., Zeng, Y.C., Brown, S.H.J., Sobti, M., Stewart, A.G. | Deposition date: | 2023-09-01 |
|
PDBID: | 8u1p | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-01 | Release date: | 2025-01-26 |
|
PDBID: | 8qeh | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 | Release date: | 2024-11-30 |
|
PDBID: | 8qeg | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 | Release date: | 2025-03-04 |
|
PDBID: | 8p85 | Status: | AUTH -- processed, waiting for author review and approval | Title: | 80S yeast ribosome in complex with Fluorolissoclimide | Authors: | Terrosu, S., Yusupov, M. | Deposition date: | 2023-08-31 |
|
PDBID: | 8qea | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|
PDBID: | 8qem | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|
PDBID: | 8qek | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|
PDBID: | 8qej | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|
PDBID: | 8qei | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|
PDBID: | 8u1a | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|
PDBID: | 8w7r | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | H. walsbyi bacteriorhodopsin mutant - W94F | Authors: | Li, G.Y., Chen, J.C., Yang, C.S. | Deposition date: | 2023-08-31 | Release date: | 2024-08-31 |
|
PDBID: | 8qdp | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-30 |
|
PDBID: | 8qds | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-30 |
|