PDBID: | 8k09 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-07 | Release date: | 2025-01-07 |
|
PDBID: | 8k08 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-07 | Release date: | 2025-01-07 |
|
PDBID: | 8tf0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-07 | Release date: | 2025-01-15 |
|
PDBID: | 8tf5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-07 | Release date: | 2025-01-07 |
|
PDBID: | 8tez | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | Deposition date: | 2023-07-07 | Release date: | 2024-08-01 |
|
PDBID: | 8tf1 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH and Pyridoxal | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | Deposition date: | 2023-07-07 | Release date: | 2024-08-01 |
|
PDBID: | 8tf6 | Status: | HPUB -- hold until publication | Title: | X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution | Authors: | Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ? | Deposition date: | 2023-07-07 | Release date: | 2025-01-08 | Sequence: | >Entity 1 (MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8jzq | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-06 | Release date: | 2025-01-06 |
|
PDBID: | 8jzp | Status: | HOLD -- hold until a certain date | Title: | Structure of mouse C5a-human C5aR1-Go complex | Authors: | Yadav, M.K., Yadav, R., Maharana, J., Sarma, P., Banerjee, R., Shukla, A.K., Gati, C. | Deposition date: | 2023-07-06 | Release date: | 2025-01-06 |
|
PDBID: | 8jzt | Status: | AUTH -- processed, waiting for author review and approval | Title: | The sigF and anti-sigma factor complex | Authors: | Chen, Y.J., Su, D. | Deposition date: | 2023-07-06 | Release date: | 2024-08-06 |
|
PDBID: | 8pox | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Crystal Structure of the C19G variant of the membrane-bound [NiFe]-Hydrogenase from Cupriavidus necator in the H2-reduced state at 1.6 A Resolution. | Authors: | Kalms, J., Schmidt, A., Scheerer, P. | Deposition date: | 2023-07-05 |
|
PDBID: | 8poy | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Crystal Structure of the C120G variant of the membrane-bound [NiFe]-Hydrogenase from Cupriavidus necator in the air-oxidized state at 1.93 A Resolution. | Authors: | Schmidt, A., Kalms, J., Scheerer, P. | Deposition date: | 2023-07-05 |
|
PDBID: | 8poz | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Crystal Structure of the C120G variant of the membrane-bound [NiFe]-Hydrogenase from Cupriavidus necator in the H2-reduced state at 1.65 A Resolution. | Authors: | Schmidt, A., Kalms, J., Scheerer, P. | Deposition date: | 2023-07-05 |
|
PDBID: | 8te8 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Pyridoxal Reductase (PDXI) | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | Deposition date: | 2023-07-05 | Release date: | 2024-08-01 |
|
PDBID: | 8jz9 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-04 | Release date: | 2025-02-04 |
|
PDBID: | 8jy1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-02 | Release date: | 2024-08-02 |
|
PDBID: | 8jxr | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-01 | Release date: | 2025-01-01 |
|
PDBID: | 8jxs | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-01 | Release date: | 2025-01-01 |
|
PDBID: | 8jxy | Status: | AUTH -- processed, waiting for author review and approval | Title: | lysozyme with in situ device | Authors: | Liang, M., Wang, Q. | Deposition date: | 2023-07-01 | Release date: | 2025-01-01 |
|
PDBID: | 8tci | Status: | HPUB -- hold until publication | Title: | Crystal structure of DNMT3C-DNMT3L in complex with CGG DNA | Authors: | Khudaverdyan, N., Song, J. | Deposition date: | 2023-07-01 | Release date: | 2025-01-01 |
|
PDBID: | 8pns | Status: | HPUB -- hold until publication | Title: | Crystal structure of the acyl-CoA dehydrogenase PA0506 (FadE1) from Pseudomonas aeruginosa | Authors: | Wang, M., Brear, P., Welch, M. | Deposition date: | 2023-06-30 | Release date: | 2024-12-30 |
|
PDBID: | 8png | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the apo acyl-CoA dehydrogenase FadE2 (PA0508) from Pseudomonas aeruginosa | Authors: | Wang, M., Brear, P., Welch, M. | Deposition date: | 2023-06-30 | Release date: | 2024-12-30 |
|
PDBID: | 8pnn | Status: | AUTH -- processed, waiting for author review and approval | Title: | 80S yeast ribosome in complex with Bromolissoclimide | Authors: | Terrosu, S., Yusupov, M. | Deposition date: | 2023-06-30 |
|
PDBID: | 8pnf | Status: | HPUB -- hold until publication | Title: | HRV B14 virion proteins | Authors: | Gil-Cantero, D., Mata, C.P., Mateu, M.G., Caston, J.R. | Deposition date: | 2023-06-30 | Release date: | 2024-12-30 |
|
PDBID: | 8pnb | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-30 | Release date: | 2024-12-30 |
|