| PDBID: | 8xhx | | Status: | HPUB -- hold until publication | | Title: | The complex structure of PaBcmG and its natural substrate | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhy | | Status: | HPUB -- hold until publication | | Title: | The complex structure of mutant T307A of SsBcmE and its natural substrate cIL | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhz | | Status: | HPUB -- hold until publication | | Title: | protein-DNA complex | | Authors: | Li, Z. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8rhy | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P34 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rhv | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P30 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rhu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P25 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rhw | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P31 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rhx | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P32 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rht | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei DHFR in complex with the cofactor and inhibitor P25 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
GSHMLSLTRILRKKIPVHELAGKISRPPLRPFSVVVASDEKGGIGDGGTIPWEIPEDMQYFRRVTTNLRGKNVKPSPSKRNAVVMGRKTWDSLPPKFRPLSNRLNVVLSRSATKEQLLAGIPDPIKRAEAANDVVAVNGGLEDALRMLVSKEHTSSIETVFCIGGGTIYKQALCAPCVNVLQAIHRTVVRPASNSCSVFFDIPAAGTKTPEGLELVRESITDERVSTGAGGKKYQFEKLVPRNS
|
|
| PDBID: | 8xhe | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xhf | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xhj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-HBA complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xh8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xhi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Toxin BmKaTX15-7A | | Authors: | Gu, M.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xhg | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xhh | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xgz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-16 |
|
| PDBID: | 8rhd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Neisseria gonorrhoeae FabI in complex with NADH and (E)-3-((2R,3S)-3-hydroxy-2-methyl-4-oxo-2,3,4,5-tetrahydro-1H-pyrido[2,3-b][1,4]diazepin-8-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide | | Authors: | Ronin, C., Gerusz, V., Ciesielski, F. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 | | Sequence: | >Entity 1
GPGSRTPVELRLTEIFRDVLGHDAFGVLDDFFELGGDSFKAIRIAAKYGPPLEVTDIYDHPTIEALAAHLAR
|
|
| PDBID: | 8rhb | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rha | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rho | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
