PDBID: | 8wjb | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 8wi6 | Status: | HPUB -- hold until publication | Title: | Crystal structure of AtHPPD-ZSM824 complex | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-09-24 |
|
PDBID: | 8wie | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-24 |
|
PDBID: | 8wi1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-24 |
|
PDBID: | 8ubs | Status: | HPUB -- hold until publication | Title: | Crystal structure of NrdJ-1 split intein fusion | Authors: | Kofoed, C., Ye, X., Jeffrey, P.D., Muir, T.W. | Deposition date: | 2023-09-24 |
|
PDBID: | 8ubq | Status: | HPUB -- hold until publication | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and 2-benzyl-4-phenylthiazole-5-carboxylic acid | Authors: | Wang, G., Heras, B. | Deposition date: | 2023-09-24 | Sequence: | >Entity 1 AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
PDBID: | 8ubt | Status: | HPUB -- hold until publication | Title: | Structure of SCF-FBXL17-BACH1BTB E3 ligase complex | Authors: | Shi, H., Cao, S. | Deposition date: | 2023-09-24 |
|
PDBID: | 8ubj | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubk | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubl | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubm | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubn | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubo | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubp | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubi | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8wht | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8whn | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8whr | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8whh | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8whd | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8whc | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8whe | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-23 |
|
PDBID: | 8whg | Status: | HPUB -- hold until publication | Title: | imine reductase mutant - M3 | Authors: | Zhu, X.X., Chen, X.R., Zheng, G.W. | Deposition date: | 2023-09-23 |
|
PDBID: | 8whf | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8whi | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|