PDBID: | 7gy3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-09 |
|
PDBID: | 7gwo | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 7gun | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 7guo | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 7gxa | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 7gxb | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 7gxc | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 7gxt | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-09 |
|
PDBID: | 7gvg | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 7gx9 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 7gxu | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-09 |
|
PDBID: | 7gxv | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-09 |
|
PDBID: | 7gvd | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 7gve | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 7gvf | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 8vks | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8vkg | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-09 |
|
PDBID: | 8vkh | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-09 |
|
PDBID: | 8xs2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 | Sequence: | >Entity 1 MATGQVKLQQSGAEFVKAGASVKLSCKTSGYTFNNYWIHWVKQSPGQGLEWIGEIDPSDGYSNYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCTSSTSVGGSWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSASAAHHHHHHGAAEQKLISEEDLNGAA
>Entity 2 MSDIELTQSPLSLPVSLGDQASISCTSSQSLLHSNGDTYLHWYLQKPGQSPKLLIYTLSNRFSGVPDRFSGSGSGTDFTLKISRVEAADLGIYFCSQTTHVPYTFGGGTKLEIKRADAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEGGGSDYKDDDDK
|
|
PDBID: | 8xs1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8xrs | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8xrw | Status: | HOLD -- hold until a certain date | Title: | crystal structure of HpPPAT in complex with ATP | Authors: | Yin, H.S. | Deposition date: | 2024-01-08 | Release date: | 2025-01-08 |
|
PDBID: | 8xrz | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8xrq | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 BA.1 spike RBD in complex bound with VacBB-639 | Authors: | Liu, C.C., Ju, B., Zhang, Z. | Deposition date: | 2024-01-08 |
|
PDBID: | 8xrr | Status: | HPUB -- hold until publication | Title: | A complex structure of PDGFRA with an inhibitor RH140 | Authors: | Zhu, S.J., Bi, S.Z. | Deposition date: | 2024-01-08 |
|