| PDBID: | 8rss | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 | | Sequence: | >Entity 1
MEELTYRLFMVATVGMLAGTVFLLASSREVKPEHRRGVYISALVCGIAWYHYQKMGASWESGSYDTGLRYVDWVLTVPLMFVEVLAVTRKGAAYNEAVRNWGIAATVMIGAGYYGETSAAGSNEYWTGFVIAMATYVWLMRNLQAEGEGLKGDQAVAFENIKNLILVGWIIYPLGYIAPVVGDFDAIREVLYTIADIIN(LYR)VGLGVLVLQMARVQSGEKVS
|
|
| PDBID: | 8rsw | | Status: | HOLD -- hold until a certain date | | Title: | Solution NMR structure of Pacsin 2 SH3 domain | | Authors: | Tossavainen, H., Permi, P. | | Deposition date: | 2024-01-25 | | Release date: | 2024-02-22 |
|
| PDBID: | 8rsy | | Status: | HPUB -- hold until publication | | Title: | TRYPTOPHAN SYNTHASE measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Sung, S., Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., von Stetten, D., Mehrabi, P., Wilmanns, M., Schulz, E.C. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsz | | Status: | HPUB -- hold until publication | | Title: | TRYPTOPHAN SYNTHASE measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Sung, S., Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., von Stetten, D., Mehrabi, P., Schulz, E.C., Wilmanns, M. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rt1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BTV15 VP5 at pH 9.0 | | Authors: | Sutton, G.C., Stuart, D.I. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vsz | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of human GABAA receptor pi (GABRP) apo state | | Authors: | Wang, Y., Klein, D. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vt1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vt6 | | Status: | HPUB -- hold until publication | | Title: | A structural study of selectivity mechanisms for JNK3 and p38 alpha with indazole scaffold probing compounds | | Authors: | Park, H., Feng, Y. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vt0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vt3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vt2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vt4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y1i | | Status: | HOLD -- hold until a certain date | | Title: | Structure of guanosine-2''''-fluorinated [d(AACCGGTT)]2 | | Authors: | Gao, R.Q., Cao, C., Tang, G.L. | | Deposition date: | 2024-01-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 8rsh | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a silicon HARE chip | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rs1 | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rs2 | | Status: | HPUB -- hold until publication | | Title: | Thaumatin measured via serial crystallography from a silicon HARE-chip. | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sihyun, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rs3 | | Status: | HPUB -- hold until publication | | Title: | Thaumatin measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rsd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Thaumatin measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rse | | Status: | HPUB -- hold until publication | | Title: | Proteinase K measured via serial crystallography from a silicon HARE-chip | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rsf | | Status: | HPUB -- hold until publication | | Title: | Proteinase K measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rs7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Zika Virus NS2B-NS3 protease in complex with an allosteric inhibitor | | Authors: | Ontario, J.M., Torrente, E. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rsi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rsj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rsk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
