| PDBID: | 8w8v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-04 | | Release date: | 2025-03-05 |
|
| PDBID: | 8w8u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-04 | | Release date: | 2025-03-05 |
|
| PDBID: | 8w97 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -PK16 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w92 | | Status: | HPUB -- hold until publication | | Title: | human H ferritin with 2 Fe(II)/subunit loading | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w94 | | Status: | HPUB -- hold until publication | | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE exposed to H2O2 for 2 s | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8qf6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-03 |
|
| PDBID: | 8w8i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-02 | | Sequence: | >Entity 1
MKKLLIAAGSVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIALHHHHHH
>Entity 2
MKKLLIAAGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMYWVRQAPGKGLEWVSKINTNGLITKYPDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCARSPSGFNRGQGTLVTVSSHHHHHH
|
|
| PDBID: | 8qf0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-01 |
|
| PDBID: | 8qep | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-01 | | Release date: | 2025-03-01 |
|
| PDBID: | 8qeq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-01 |
|
| PDBID: | 8qew | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-01 |
|
| PDBID: | 8u1h | | Status: | HPUB -- hold until publication | | Title: | Axle-less Bacillus sp. PS3 F1 ATPase mutant | | Authors: | Furlong, E.J., Zeng, Y.C., Brown, S.H.J., Sobti, M., Stewart, A.G. | | Deposition date: | 2023-09-01 |
|
| PDBID: | 8u1p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-01 | | Release date: | 2025-01-26 |
|
| PDBID: | 8qeh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 | | Release date: | 2024-11-30 |
|
| PDBID: | 8qeg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 | | Release date: | 2025-03-04 |
|
| PDBID: | 8p85 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 80S yeast ribosome in complex with Fluorolissoclimide | | Authors: | Terrosu, S., Yusupov, M. | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8qea | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8qem | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8qek | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8qej | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8qei | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8u1a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8w7r | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | H. walsbyi bacteriorhodopsin mutant - W94F | | Authors: | Li, G.Y., Chen, J.C., Yang, C.S. | | Deposition date: | 2023-08-31 | | Release date: | 2024-08-31 |
|
| PDBID: | 8qdp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-30 |
|
| PDBID: | 8qds | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-30 |
|
