| PDBID: | 8qj2 | | Status: | HPUB -- hold until publication | | Title: | Structure of active state MC4R in complex with a potent ligand mimicking nanobody | | Authors: | Busch, A., Jaakola, V.-P., Masiulis, S. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-12 | | Release date: | 2024-09-12 |
|
| PDBID: | 8u5i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of human IDO1 bound to Compound 23 | | Authors: | Steinbacher, S., Lammens, A., Harris, S.F. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u59 | | Status: | HPUB -- hold until publication | | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-12 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8u54 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u56 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u58 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8wci | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8wcg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-1 RBD in complex with nanobody aSR29 and aSR347 | | Authors: | Zeng, W.H., Ma, H., Jin, T.C. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8wcf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of EcThsB | | Authors: | Chen, Q., Yu, Y. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qhw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi0 | | Status: | HPUB -- hold until publication | | Title: | 340A Vipp1 H1-6 helical tubes | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
