| PDBID: | 8wz7 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021(I255A,T287A) in ternary complex with NAD and adenosine | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz8 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021(T67A,Q69A) complex with NAD | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wza | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human pannexin 3 in nanodisc | | Authors: | Hang, Z., Huawei, Z., Daping, W. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz5 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 sc9-10 strain: B18537) in complex with humanized nAb 5B11 | | Authors: | Liu, L., Sun, H., Sun, Y., Zheng, Q., Li, S., Zheng, Z., Xia, N. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8r0k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-31 | | Release date: | 2024-10-31 |
|
| PDBID: | 8r0h | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with (E)-3-(2-(thiophen-2-yl)vinyl)-3,4-dihydroquinoxalin-2(1H)-one and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0q | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 6-bromo-1H-benzo[d]imidazol-2-amine and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8utz | | Status: | HPUB -- hold until publication | | Title: | E3 ubiquitin-protein ligase CBL-B in complex with compound 2 | | Authors: | Gajewski, S., Clifton, M.C. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uu0 | | Status: | HPUB -- hold until publication | | Title: | E3 ubiquitin-protein ligase CBL-B in complex with compound 6 | | Authors: | Gajewski, S., Clifton, M.C. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uu1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uti | | Status: | HPUB -- hold until publication | | Title: | Eukaryotic 80S ribosome with Reh1 and A/P site tRNA | | Authors: | Yelland, J.N., Taylor, D.W., Johnson, A.W. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uu2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uu3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uth | | Status: | HPUB -- hold until publication | | Title: | Active site binding triggers E1-rearrangements revealing E1-E2 lipoyl domain interactions in the Pyruvate dehydrogenase complex | | Authors: | Arjunan, P., Whitley, M., Furey, W. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8utj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 | | Release date: | 2025-05-16 |
|
| PDBID: | 8wyk | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (2 mM EGTA, closed state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wyl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (100 nM Ca2+, open state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wym | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (100 nM Ca2+, pre-open state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 |
|
