| PDBID: | 8whj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ELKS2/LL5beta complex | | Authors: | Jia, X., Wei, Z. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8who | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH20541 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH201042 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH21398 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 | | Sequence: | >Entity 1
GSHMVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKSEFLPGFERVEDASSFPLDYGIRRLDHAVGNVPELGPALTYVAGFTGFHQFAEFTADDVGTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFRTLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLLQIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTLEAKQLVG
|
|
| PDBID: | 8wh1 | | Status: | PROC -- to be processed | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wh3 | | Status: | HPUB -- hold until publication | | Title: | MPOX E5 hexamer apo form | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wgr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8qmd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8qmj | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of Paradendryphiella salina PL7C alginate lyase mutant H124 soaked with hexa-mannuronic acid | | Authors: | Wilkens, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8uba | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ube | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8uav | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub4 | | Status: | PROC -- to be processed | | Title: | Substrate-bound Cdc48, Consensus | | Authors: | Cooney, I., Schubert, H.L., Cedeno, K., Lin, H.J.L., Fisher, O.N., Price, J.C., Hill, C.P., Shen, P.S. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub0 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of Histidine-5''-O-adenosine phosphoramidate/RNase A | | Authors: | Pallan, P.S., Egli, M. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub2 | | Status: | HPUB -- hold until publication | | Title: | Structure of Adenosine monophosphate/RNase A | | Authors: | Pallan, P.S., Egli, M. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub1 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of Butyl-5''-O-adenosine phosphoramidate/RNase A | | Authors: | Pallan, P.S., Egli, M. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8uaz | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of Glutamyl-5''-O-adenosine phosphoramidate/RNase A | | Authors: | Pallan, P.S., Egli, M. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8uay | | Status: | HPUB -- hold until publication | | Title: | Structure of Arginyl-5''-O-adenosine phosphoramidate/RNase A | | Authors: | Pallan, P.S., Egli, M. | | Deposition date: | 2023-09-22 |
|
