| PDBID: | 8rni | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rns | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase XII mimic in complex with biguanide derivative inhibitor 1-carbamimidamido-N-[(4 sulfamoylphenyl)methyl]methanimidamide | | Authors: | Baroni, C., Ferraroni, M. | | Deposition date: | 2024-01-10 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8rnj | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnl | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with lauric acid | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8vky | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8vkx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8vkv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8vkw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xsu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt7 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of human AS3MT | | Authors: | Chun, I.S., Kim, M.S. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xqw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xsv | | Status: | HOLD -- hold until a certain date | | Title: | crystal structure of PPAT mutant P8A | | Authors: | Yin, H.S. | | Deposition date: | 2024-01-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8xtc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xsw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt8 | | Status: | HPUB -- hold until publication | | Title: | Clostridioides difficile MarR (WP_003434724) with Hg-bound | | Authors: | Park, S., Kwon, N. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xss | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xsr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xs8 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Benzo[a]pyrene | | Authors: | Diao, X., Shang, Q., Wu, D. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xsm | | Status: | HPUB -- hold until publication | | Title: | transporter | | Authors: | Jiang, D.H., Wang, K. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rmx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rmy | | Status: | HPUB -- hold until publication | | Title: | Transglutaminase 3 in complex with inhibitor Z-don and DH patient-derived Fab DH63-A02 | | Authors: | Heggelund, J.E., Sollid, L.M. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rn0 | | Status: | HPUB -- hold until publication | | Title: | Influenza polymerase A/H7N9-4M encapsidase plus 627(R) / human ANP32A (from ""Influenza polymerase A/H7N9-4M replication complex"" | Local refinement) | | Authors: | Arragain, B., Cusack, S. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rne | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
