| PDBID: | 7gy3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gwo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gun | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7guo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gxa | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gxb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gxc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gxt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gvg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gx9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gxu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gxv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gvd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gve | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gvf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8vks | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8vkg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8vkh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8xs2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 | | Sequence: | >Entity 1
MATGQVKLQQSGAEFVKAGASVKLSCKTSGYTFNNYWIHWVKQSPGQGLEWIGEIDPSDGYSNYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCTSSTSVGGSWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSASAAHHHHHHGAAEQKLISEEDLNGAA
>Entity 2
MSDIELTQSPLSLPVSLGDQASISCTSSQSLLHSNGDTYLHWYLQKPGQSPKLLIYTLSNRFSGVPDRFSGSGSGTDFTLKISRVEAADLGIYFCSQTTHVPYTFGGGTKLEIKRADAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEGGGSDYKDDDDK
|
|
| PDBID: | 8xs1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8xrs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8xrw | | Status: | HOLD -- hold until a certain date | | Title: | crystal structure of HpPPAT in complex with ATP | | Authors: | Yin, H.S. | | Deposition date: | 2024-01-08 | | Release date: | 2025-01-08 |
|
| PDBID: | 8xrz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8xrq | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 BA.1 spike RBD in complex bound with VacBB-639 | | Authors: | Liu, C.C., Ju, B., Zhang, Z. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8xrr | | Status: | HPUB -- hold until publication | | Title: | A complex structure of PDGFRA with an inhibitor RH140 | | Authors: | Zhu, S.J., Bi, S.Z. | | Deposition date: | 2024-01-08 |
|
