| PDBID: | 9crq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9crt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1 FC at natural pH | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9crx | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9iv1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9iv0 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-07-22 | | Release date: | 2025-07-22 |
|
| PDBID: | 9g7j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the tungsten-dependent aldehyde:ferredoxin oxidoreductase from Clostridium autoethanogenum. | | Authors: | Lemaire, O.N., Wagner, T. | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9g7g | | Status: | HPUB -- hold until publication | | Title: | Structure of the clippase PaJOS from Pigmentiphaga aceris | | Authors: | Baumann, U., Uthoff, M., Hermanns, T., Hofmann, K. | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9g7i | | Status: | HPUB -- hold until publication | | Title: | Structure of carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) in complex with acetyl-Coenyzme A from Clostridium autoethanogenum | | Authors: | Lemaire, O.N., Dongsheng, Y.M., Murphy, B.J., Wagner, T. | | Deposition date: | 2024-07-21 | | Sequence: | >Entity 1
MNLFQTVFTGSKQALAAAEGIVKQAVDEKGRDYKVAFPDTAYSLPVIFAATGKKITNVGELEGALDIVRSLIVEEEMLDKLLNSGLATAVAAEIIEAAKYVLSDAPYAEPCVGFISDPIIRSLGVPLVTGDIPGVAVILGECPDSETAAKIIKDYQSKGLLTCLVGKVIDQAIEGKVKMGLDLRVIPLGYDVTSVIHVVTIAIRAALIFGGIKGGQLNDILKYTAERVPAFVNAFGPLSELVVSAGAGAIALGFPVLTDQVVPEVPTLLLTQKDYDKMVKTSLEARNIKIKITEIPIPVSFAAAFEGERIRKNDMLAEFGGNKTKAWELVMCADQGEVEDHKIEVIGPDIDTIDKAPGRMPLGMLIKVSGTNMQKDFEPVLERRLHYFLNYIEGVMHVGQRNLTWVRIGKEAFEKGFRLKHFGEVIYAKMLDEFGSVVDKCEVTIITDPGKAEELEGKYAVPRYKERDARLESLVDEKVDTFYSCNLCQSFAPAHVCIVTPERLGLCGAVSWLDAKATLELNPTGPCQAVPKEGVVDENLGIWEKVNETVSKISQGAVTSVTLYSILQDPMTSCGCFECITGIMPEANGVVMVNREFGATTPLGMTFGELASMTGGGVQTPGFMGHGRQFIASKKFMKGEGGLGRIVWMPKELKDFVAEKLNKTAKELYNIDNFADMICDETIATESEEVVKFLEEKGHPALKMDPIM
>Entity 2
MEEKAKSIDQATLQLLDKAKQDGVETVWDRKADMKVQCGFGSAGVCCRNCSMGPCRVSPVPGKGVERGICGATADVIVSRNFARMVAAGTAAHSDHGRSIALSLYHTSKDGDIKVKDENKLKEVAKSFNVETEGRDIYDIAHDVAKEGLSNYGKQLGEVTLPPSLPEKRKELWRKLGVYPRAVDREIAAVMHSTHIGCNADAEAMIKMSMRCSLTDGWMGSFMGTEFSDIMFGTPHSIDTEANLGVLEKNSVNVVLHGHEPLLSEMVVEAASDPELVELAKSVGADGINLCGMCCTGNEVSMRHGIKIAGNFMQQELAVVTGAVDGLIVDVQCIMPALAKLSKSYHTKFITTSPKAHITDSIYMEFDEENPLDSAKKILKEAILNFKNRDQSKVMIPELKCKAILGYSVEEIINKLDKVVNTQIGPMQTVKPLADVLVSGVLRGAAAVVGCNNPKVVQDSAHIETIKGLIKNDVIVVVTGCAAQAAAKYGLLQKEAAEKYAGPGLATVCKLVDIPPVLHMGSCVDISRILDLVGRVANLLGVDMSDLPVAGVAPEWMSEKAVAIGTYVVTSGIDTWLGVAPPVTGGPEVVDILTNKMEDWVGAKFFIETDPHKAVEQIVNRMNEKRKKLGI
|
|
| PDBID: | 9iug | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9iuf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9iui | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9cr8 | | Status: | HPUB -- hold until publication | | Title: | SapNP reconstituted human ABCB1 | | Authors: | Kurre, D., Alam, A. | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9cr9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9cra | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9g7e | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ASGPR with bound guanosine | | Authors: | Schreuder, H.A., Hofmeister, A. | | Deposition date: | 2024-07-20 | | Sequence: | >Entity 1
MGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLLGSHHHHHH
|
|
| PDBID: | 9g7a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g79 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g7f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g7b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g7d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ASGPR with bound IMP | | Authors: | Schreuder, H.A., Hofmeister, A. | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9iu8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9iu9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9iud | | Status: | HPUB -- hold until publication | | Title: | High resolution structure of Lectin-Like ox-LDL Receptor 1 with BI-0115 in space group P 21 21 21 | | Authors: | Khan, M.A., Arulandu, A. | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9itj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9itf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-20 |
|
