| PDBID: | 9ecy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-15 |
|
| PDBID: | 9ed0 | | Status: | HPUB -- hold until publication | | Title: | Human LARP1 bound to the 40S small ribosomal subunit | | Authors: | Dong, W., Kaufhold, R., Brito Querido, J. | | Deposition date: | 2024-11-15 |
|
| PDBID: | 9ecu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the inactive BRAF/MEK1 complex bound to IK-595 | | Authors: | Yang, A. | | Deposition date: | 2024-11-15 |
|
| PDBID: | 9ecv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM Structure Of Respiratory Syncytial Virus Polymerase in complex with Novel Non-Nucleoside Inhibitor Compound 16 | | Authors: | Yin, Y., Tran, M.T., Yu, X., Jonckers, T., Carney, C. | | Deposition date: | 2024-11-15 |
|
| PDBID: | 9ecw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-15 |
|
| PDBID: | 9ed2 | | Status: | HPUB -- hold until publication | | Title: | CryoEM map of Respiratory Syncytial Virus Polymerase with Non-Nucleoside Inhibitor compound 21 | | Authors: | Yin, Y., Tran, M.T., Yu, X., Jonckers, T., Carney, S. | | Deposition date: | 2024-11-15 |
|
| PDBID: | 9ed6 | | Status: | HPUB -- hold until publication | | Title: | CryoEM map of the mLST8-Rag-Ragultor subcomplex | | Authors: | Cui, Z., Hurley, J. | | Deposition date: | 2024-11-15 |
|
| PDBID: | 9ed4 | | Status: | HPUB -- hold until publication | | Title: | A composite map of mTORC1-Rag-Ragultor-4EBP1 on membrane | | Authors: | Cui, Z., Hurley, J. | | Deposition date: | 2024-11-15 |
|
| PDBID: | 9ed5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-15 |
|
| PDBID: | 9hf4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human TRF1 TRFH domain in complex with compound 32 | | Authors: | Casale, G., Le Bihan, Y.-V., Van Montfort, R.L.M., Guettler, S. | | Deposition date: | 2024-11-15 | | Sequence: | >Entity 1
SNAQVQVGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKR
|
|
| PDBID: | 9hf6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human TRF1 TRFH domain in complex with compound 1 | | Authors: | Casale, G., Le Bihan, Y.-V., Van Montfort, R.L.M., Guettler, S. | | Deposition date: | 2024-11-15 | | Sequence: | >Entity 1
SNAQVQVGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKR
|
|
| PDBID: | 9hf7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human TRF1 TRFH domain in complex with compound 3 | | Authors: | Casale, G., Le Bihan, Y.-V., van Montfort, R.L.M., Guettler, S. | | Deposition date: | 2024-11-15 | | Sequence: | >Entity 1
SNAQVQVGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKR
|
|
| PDBID: | 9hf3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hf2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hf1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hf0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hez | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hey | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hex | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hew | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hev | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kks | | Status: | HOLD -- hold until a certain date | | Title: | Solution NMR structure of Pseudoazurin | | Authors: | Yamaguchi, T., Obara, Y., Fujikawa, K., Yamasaki, K., Kohzuma, T. | | Deposition date: | 2024-11-14 | | Release date: | 2025-11-14 | | Sequence: | >Entity 1
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
|
|
| PDBID: | 9kl3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pleurocybella porrigens lectin (PPL) in complex with GalNAc | | Authors: | Adachi, D., Ishimoto, N., Kawabata, H., Mizutani, K., Park, S.-Y., Tame, J.R.H., Kamata, K. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kkn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
