| PDBID: | 9dxx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in complex with D-peptide | | Authors: | Kadam, R.U., Wilson, I.A. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dy3 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of C4-Dicarboxylate-Binding Periplasmic Protein (PA5167) of Tripartite ATP-independent Periplasmic Transporter Family from Pseudomonas aeruginosa PAO1 in Complex with L-Malate | | Authors: | Minasov, G., Shukla, S., Shuvalova, L., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-10-12 | | Sequence: | >Entity 1
SNAADPIVIKFSHVVAEHTPKGQGALLFKKLVEERLPGKVKVEVYPNSSLFGDGKE(MSE)EALLLGDVQIIAPSLAKFEQYTKKLQIFDLPFLFDNIQAVDRFQQSPQGKELLTS(MSE)QDKGITGLGYWHNG(MSE)KQLSANKPLREPKDARGLKFRVQASKVLEEQFKAVRANPRK(MSE)SFAEVYQGLQTGVVNGTENPWSNIYSQK(MSE)HEVQKYITESDHGVLDY(MSE)VITNTKFWNGLPEDVRGVLAKT(MSE)DEVTVEVNKQAEALNQGDKQRIVEAKTSEIIELTPEQRAEWRKA(MSE)QPVWKKFEGEIGADLIKAAEAANQAQ
|
|
| PDBID: | 9jy5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in state EA1 | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jy6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in state EA1_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jy7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in state EA2.1 | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jy8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in state EA2.1_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jy9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-inhibited state SB_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jya | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-inhibited state SD4.0_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jyb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-engaged state ED0.0_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jyc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-engaged state ED0.1_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jyd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-engaged state ED1.0_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jye | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-engaged state ED1.1_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jyf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-engaged state ED2.0_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jyh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-engaged state ED2.2_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jyi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-engaged state ED3_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jyj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-engaged state ED4.0_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jyt | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-12 | | Release date: | 2025-10-12 |
|
| PDBID: | 9jxv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jxy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Small GTPase RhoA C16R mutant in complex with GTP analogue | | Authors: | Zu, S., Wu, H. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jym | | Status: | HPUB -- hold until publication | | Title: | YdiU complexed with NAD and Mn2+ | | Authors: | Liu, K., Zhang, T., Wang, T., Xiang, S. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jyn | | Status: | HPUB -- hold until publication | | Title: | YdiU complexed with NAD | | Authors: | Liu, K., Zhang, T., Wang, T., Xiang, S. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jyo | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-12 | | Release date: | 2025-10-12 |
|
| PDBID: | 9jyp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-12 | | Release date: | 2025-10-12 |
|
| PDBID: | 9jyr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-12 | | Release date: | 2025-10-12 |
|
| PDBID: | 9jys | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-12 | | Release date: | 2025-10-12 |
|
