| PDBID: | 9f1p | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-10-19 |
|
| PDBID: | 9f1o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z51 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z52 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z63 | | Status: | HPUB -- hold until publication | | Title: | alpha-L-fucosidase from Pontiella sulfatireligans F21 | | Authors: | Zhao, P., Bai, L., Wang, S. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the hGPR68-Gs complex in pH6.0 | | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z68 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR68-Gs complex in pH6.8 | | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z65 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR4-Gs complex in pH7.2 | | Authors: | Zhong, Y.N., Guo, L.L. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z66 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the receptor of hGPR4-Gs complex in pH7.2 | | Authors: | Zhong, Y.N., Guo, L.L. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5b | | Status: | HPUB -- hold until publication | | Title: | The X-Ray crystal structure of multicopper oxidase from Bacillus freudenreichii | | Authors: | Qian, H., Wang, Y. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z59 | | Status: | HPUB -- hold until publication | | Title: | The X-Ray crystal structure of multicopper oxidase from Sulfurimonas sp. | | Authors: | Wang, Y., Qian, H. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z67 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR68-Gs complex in pH6.8 | | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z54 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human SIRT5 in complex with succinylated Prx1 fragment | | Authors: | Yokoyama, T., Takayama, Y. | | Deposition date: | 2024-04-18 | | Sequence: | >Entity 1
MHHHHHHPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>Entity 2
SKEYFSKQK
|
|
| PDBID: | 8z55 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human SIRT5 in complex with succPrx1 and ADP ribose | | Authors: | Yokoyama, T., Takayama, Y. | | Deposition date: | 2024-04-18 | | Sequence: | >Entity 1
MHHHHHHPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>Entity 2
SKEYFSKQK
|
|
| PDBID: | 8z56 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Q140L-SIRT5 in complex with succinylated Prx1 fragment | | Authors: | Yokoyama, T., Takayama, Y. | | Deposition date: | 2024-04-18 | | Sequence: | >Entity 1
MHHHHHHPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITLNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>Entity 2
SKEYFSKQK
|
|
| PDBID: | 8z57 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Q140L-SIRT5 in complex with succinylated Prx1 fragment and ADP ribose | | Authors: | Yokoyama, T., Takayama, Y. | | Deposition date: | 2024-04-18 | | Sequence: | >Entity 1
MHHHHHHPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITLNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>Entity 2
SKEYFSKQK
|
|
