PDBID: | 9cso | Status: | AUTH -- processed, waiting for author review and approval | Title: | 16mer self-complementary duplex RNA with s(2)C:G pair sequence 1 | Authors: | Fang, Z., Jia, X., Szostak, J.W. | Deposition date: | 2024-07-24 |
|
PDBID: | 9csp | Status: | AUTH -- processed, waiting for author review and approval | Title: | 16mer self-complementary duplex RNA with s(2)C:G pair sequence 2 | Authors: | Fang, Z., Jia, X., Szostak, J.W. | Deposition date: | 2024-07-24 |
|
PDBID: | 9csq | Status: | AUTH -- processed, waiting for author review and approval | Title: | 16mer self-complementary duplex RNA with s(2)C:I pair sequence 1 | Authors: | Fang, Z., Jia, X., Szostak, J.W. | Deposition date: | 2024-07-24 |
|
PDBID: | 9csr | Status: | AUTH -- processed, waiting for author review and approval | Title: | 16mer self-complementary duplex RNA with s(2)C:I pair sequence 2 | Authors: | Fang, Z., Jia, X., Szostak, J.W. | Deposition date: | 2024-07-24 |
|
PDBID: | 9csl | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|
PDBID: | 9csn | Status: | HPUB -- hold until publication | Title: | Crystal structure of human ribonuclease 7 (RNase 7) in complex with 5''-adenosine monophosphate (5''-AMP) | Authors: | Tran, T.T.Q., Pham, N.T.H., Calmettes, C., Doucet, N. | Deposition date: | 2024-07-24 |
|
PDBID: | 9csx | Status: | HPUB -- hold until publication | Title: | matrix metalloproteinase-10 proenzyme | Authors: | Isiorho, E.A. | Deposition date: | 2024-07-24 |
|
PDBID: | 9csm | Status: | HPUB -- hold until publication | Title: | Crystal structure of human ribonuclease 7 (RNase 7, HsR7) | Authors: | Tran, T.T.Q., Pham, N.T.H., Calmettes, C., Doucet, N. | Deposition date: | 2024-07-24 |
|
PDBID: | 9ct3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|
PDBID: | 9ctc | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-24 |
|
PDBID: | 9csj | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of human glyoxalase domain-containing protein 4 (GLOD4) at 2.33 A resolution. | Authors: | Griswold-Prenner, I., Dou, Y., Jennings, A., Kayser, F. | Deposition date: | 2024-07-24 |
|
PDBID: | 9css | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of SARS-CoV-2 spike protein Ecto-domain with internal tag, 1UP RBD conformation | Authors: | Singh, S., Hasan, S.S. | Deposition date: | 2024-07-24 |
|
PDBID: | 9ct7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|
PDBID: | 9ct4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|
PDBID: | 9ct5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|
PDBID: | 9cta | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|
PDBID: | 9ct8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|
PDBID: | 9ct9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|
PDBID: | 9csk | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|
PDBID: | 9cst | Status: | HPUB -- hold until publication | Title: | Streptavidin-E101Q-K121A bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | Deposition date: | 2024-07-24 | Sequence: | >Entity 1 MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAQARINTQWLLTSGTTEANAWASTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
|
PDBID: | 9csu | Status: | HPUB -- hold until publication | Title: | Streptavidin-E101Q-S112Y-K121A bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | Deposition date: | 2024-07-24 | Sequence: | >Entity 1 MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAQARINTQWLLTYGTTEANAWASTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
|
PDBID: | 9csv | Status: | HPUB -- hold until publication | Title: | Streptavidin-E101Q-S112Y-K121A bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor, oxidized by hydrogen peroxide | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | Deposition date: | 2024-07-24 | Sequence: | >Entity 1 MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAQARINTQWLLTYGTTEANAWASTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
|
PDBID: | 9csw | Status: | HPUB -- hold until publication | Title: | Streptavidin-E101Q-S112A-K121Y bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | Deposition date: | 2024-07-24 | Sequence: | >Entity 1 MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAQARINTQWLLTAGTTEANAWYSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
|
PDBID: | 9ct6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|
PDBID: | 9ctb | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|