PDBID: | 8kcp | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcs | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human gamma-secretase in complex with BMS906024 | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kct | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human gamma-secretase in complex with Nirogacestat | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcu | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human gamma-secretase in complex with MK-0752 | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kd1 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2025-02-08 |
|
PDBID: | 8kcn | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-08 |
|
PDBID: | 8q54 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | N5-methyl-H4MPT:CoM methyltransferase -coenzyme M complex | Authors: | Aziz, I., Vonck, J., Ermler, U. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcv | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of UDA01-CAAMDDFQL | Authors: | Tang, Z., Zhang, N. | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8tqq | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8tqr | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8tqn | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8tqy | Status: | HPUB -- hold until publication | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | Deposition date: | 2023-08-08 | Release date: | 2025-01-08 | Sequence: | >Entity 1 MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8tqw | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqt | Status: | HPUB -- hold until publication | Title: | MPI52 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqu | Status: | HPUB -- hold until publication | Title: | MPI51 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-08 |
|
PDBID: | 8q51 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-07 |
|
PDBID: | 8q4y | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-07 |
|
PDBID: | 8q4s | Status: | HPUB -- hold until publication | Title: | Crystal structure of phosphoserine phosphatase (SerB) from Brucella melitensis in complex with AP4 and magnesium. | Authors: | Scaillet, T., Wouters, J. | Deposition date: | 2023-08-07 |
|
PDBID: | 8kcd | Status: | HPUB -- hold until publication | Title: | Complex of DDM1-nucleosome(H2A.W) complex with DDM1 bound to SHL2 and SHL-2 | Authors: | Zhang, H., Zhang, Y. | Deposition date: | 2023-08-07 |
|
PDBID: | 8kch | Status: | AUTH -- processed, waiting for author review and approval | Title: | Sus scrofa complex I close state 2 from supercomplex I+III2+IV in the presence of proguanil | Authors: | Teng, F., Hu, Y.Q., Zhou, L. | Deposition date: | 2023-08-07 |
|
PDBID: | 8kcg | Status: | AUTH -- processed, waiting for author review and approval | Title: | Sus scrofa complex I close state 3 from supercomplex I+III2+IV in the presence of proguanil | Authors: | Teng, F., Hu, Y.Q., Zhou, L. | Deposition date: | 2023-08-07 |
|
PDBID: | 8kcj | Status: | HPUB -- hold until publication | Title: | De novo design protein -N7 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-07 |
|
PDBID: | 8kck | Status: | HPUB -- hold until publication | Title: | De novo design protein -N9 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-07 | Sequence: | >Entity 1 GAEAAAAAAVTAELRAFRAAGGTVELEDLPVTPETLARAEAALARLPPESVAVETYTVPAPTPEAFLAALEAALARLAAEGLPAILLRVVDADGNLVGSILVAAAGPPAESAAATGRVLTIYVASSPEGLKVARGLAIETRDAGGLALAIGASGAWALAGLAGALALARRLAEAHGAPVRVVTIGDPANPTDAALAAAIRAAYAAALEHHHHHH
|
|
PDBID: | 8kce | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-07 |
|
PDBID: | 8tqf | Status: | HPUB -- hold until publication | Title: | Crystal structure of Soybean SHMT8 in complex with PLP-glycine and diglutamylated 5-formyltetrahydrofolate | Authors: | Owuocha, L.F., Beamer, L.J. | Deposition date: | 2023-08-07 |
|