| PDBID: | 8wzw | | Status: | HPUB -- hold until publication | | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A C240S/C393S/D394N | | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8wzr | | Status: | HPUB -- hold until publication | | Title: | SFX structure of an Mn-carbonyl complex immobilized in hen egg white lysozyme microcrystals, 100 ns after photoexcitation at RT. | | Authors: | Maity, B., Shoji, M., Luo, F., Nakane, T., Abe, S., Owada, S., Kang, J., Tono, K., Tanaka, R., Thuc, T.T., Kojima, M., Hishikawa, Y., Tanaka, J., Tian, J., Noya, H., Nakasuji, Y., Asanuma, A., Yao, X., Iwata, S., Shigeta, Y., Nango, E., Ueno, T. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8wzt | | Status: | HPUB -- hold until publication | | Title: | SFX structure of an Mn-carbonyl complex immobilized in hen egg white lysozyme microcrystals, 1 microsecond after photoexcitation at RT. | | Authors: | Maity, B., Shoji, M., Luo, F., Nakane, T., Abe, S., Owada, S., Kang, J., Tono, K., Tanaka, R., Thuc, T.T., Kojima, M., Hishikawa, Y., Tanaka, J., Tian, J., Noya, H., Nakasuji, Y., Asanuma, A., Yao, X., Iwata, S., Shigeta, Y., Nango, E., Ueno, T. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8wzv | | Status: | HPUB -- hold until publication | | Title: | SFX structure of an Mn-carbonyl complex immobilized in hen egg white lysozyme microcrystals, 1 microsecond after photoexcitation with 40 microJoules laser intensity at RT. | | Authors: | Maity, B., Shoji, M., Luo, F., Nakane, T., Abe, S., Owada, S., Kang, J., Tono, K., Tanaka, R., Thuc, T.T., Kojima, M., Hishikawa, Y., Tanaka, J., Tian, J., Noya, H., Nakasuji, Y., Asanuma, A., Yao, X., Iwata, S., Shigeta, Y., Nango, E., Ueno, T. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8x00 | | Status: | HPUB -- hold until publication | | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A C240S/C393S/D394C | | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8wz3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nAb 5B11 | | Authors: | Liu, L., Sun, H., Sun, Y., Zheng, Q., Li, S., Zheng, Z., Xia, N. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz0 | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 3CLpro bound to covalent inhibitor | | Authors: | Peng, J., Sun, D., Ding, X. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wzf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wyz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz9 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021 in ternary complex with NAD and adenine | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz4 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nAb 5B11 (localized refinement) | | Authors: | Liu, L., Sun, H., Sun, Y., Zheng, Q., Li, S., Zheng, Z., Xia, N. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8r0w | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 5-bromobenzo[d]oxazol-2-amine and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-11-01 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0y | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 3-((3-hydroxyphenyl)amino)quinoxaline-2-carboxylic acid and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-11-01 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r13 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Alpha-1-antitrypsin (Met374Phe) in the native conformation | | Authors: | Aldobiyan, I., Lomas, D.A., Irving, J.A. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8r0z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8r1e | | Status: | HPUB -- hold until publication | | Title: | crystal structure of acyl-CoA dehydrogenase FadE2 mutant (PA0508 M130G E296A Q303A) from Pseudomonas aeruginosa | | Authors: | Wang, M., Brear, P., Welch, M. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8r1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8uuc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8uud | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8uut | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8uus | | Status: | HPUB -- hold until publication | | Title: | Structure of Serratia proteamaculans antifeeding prophage Fibre foot domain (AfpX13) | | Authors: | Young, P.G., Hurst, M.R.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8uui | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8uuj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8uur | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-11-01 |
|
