| PDBID: | 8rly | | Status: | HPUB -- hold until publication | | Title: | E. coli endonuclease IV complexed with sulfate, catalytic Fe2+ | | Authors: | Saper, M.A., Paterson, N.G., Kirillov, S., Rouvinski, A. | | Deposition date: | 2024-01-04 | | Sequence: | >Entity 1
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQTEKAVA
|
|
| PDBID: | 8rm1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rlz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rlw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rm3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ferrioxamine transporter FoxA | | Authors: | Josts, I., Tidow, H., Mislin, G. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rlx | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase T188A mutant | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rm2 | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase T188E mutant | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8vii | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8vig | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8vil | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8vif | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 spike omicron (BA.1) ectodomain trimer in complex with SC27 Fab, local refinement | | Authors: | Byrne, P.O., McLellan, J.S. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8vie | | Status: | HPUB -- hold until publication | | Title: | 2-PPA bound human TMEM175 | | Authors: | Oh, S., Hite, R.K. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8vim | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8vik | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8vih | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xph | | Status: | HPUB -- hold until publication | | Title: | Marine Planctomycetes laminarinase PtLam | | Authors: | Yang, J. | | Deposition date: | 2024-01-03 |
|
| PDBID: | 8xp4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-03 |
|
| PDBID: | 8xp6 | | Status: | HPUB -- hold until publication | | Title: | 2OG-Fe(II) oxygenase-ColD | | Authors: | Zhang, B., Shi, J., Zhang, Y., Ge, H.M. | | Deposition date: | 2024-01-03 |
|
| PDBID: | 8xp7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-03 |
|
| PDBID: | 8xpf | | Status: | HPUB -- hold until publication | | Title: | 2OG-Fe(II) oxygenase-ColD in complex with collinodins | | Authors: | Zhang, B., Shi, J., Zhang, Y., Ge, H.M. | | Deposition date: | 2024-01-03 |
|
| PDBID: | 8xpj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-03 |
|
| PDBID: | 8xpk | | Status: | HPUB -- hold until publication | | Title: | Marine bacterial laminarinase PtLam mutant E154A in complex with laminatriose | | Authors: | Yang, J. | | Deposition date: | 2024-01-03 |
|
| PDBID: | 8xpi | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-03 | | Release date: | 2025-01-03 |
|
| PDBID: | 8xpl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-03 |
|
| PDBID: | 8rlt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-03 |
|
