| PDBID: | 8vj1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vj4 | | Status: | HPUB -- hold until publication | | Title: | X-ray Counterpart to the Neutron Structure of Peroxide-Soaked Trp161Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-01-05 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 8vj8 | | Status: | HPUB -- hold until publication | | Title: | X-ray Counterpart to Neutron Structure of Reduced Trp161Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-01-05 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 8viu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vj5 | | Status: | HPUB -- hold until publication | | Title: | Peroxide-Soaked MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-01-05 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 8xpp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xpo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xq0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of spleen tyrosine kinase(SYK)in complex with SKI-G-1653 | | Authors: | Bong, S.M., Lee, B.I. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xq2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of spleen tyrosine kinase(SYK)in complex with SKI-G-1693 | | Authors: | Bong, S.M., Lee, B.I. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xps | | Status: | HPUB -- hold until publication | | Title: | Structure of Nipah virus Bangladesh string G protein ectodomain monomer bound to single-domain antibody n425 at 3.22 Angstroms overall resolution | | Authors: | Sun, L., Chen, Z., Sun, Y., Mao, Q. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xpu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xpq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xpw | | Status: | HPUB -- hold until publication | | Title: | Marine bacterial laminarinase PtLam treated with 100 mM EDTA | | Authors: | Yang, J. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xq3 | | Status: | HPUB -- hold until publication | | Title: | Structure of Nipah virus Bangladesh string G protein ectodomain tetramer bound to single-domain antibody n425 at 5.87 Angstroms overall resolution | | Authors: | Sun, L., Chen, Z., Sun, Y., Mao, Q. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xpy | | Status: | HPUB -- hold until publication | | Title: | Structure of Nipah virus Malaysia string G protein ectodomain monomer bound to single-domain antibody n425 at 3.63 Angstroms overall resolution | | Authors: | Sun, L., Chen, Z., Sun, Y., Mao, Q. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xpr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human eIF4A1-ATP analog-Rohinitib-polypurine RNA complex | | Authors: | Ito, T., Sakamoto, A. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xq4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xq7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xq8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xq9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xqa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xq1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of spleen tyrosine kinase(SYK) in complex with SKI-G-1673 | | Authors: | Bong, S.M., Lee, B.I. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rm0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
