| PDBID: | 8z35 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z36 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HOIP PUB domain in complex with sertraline complex | | Authors: | Zhong, F., Ruan, K. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z34 | | Status: | HPUB -- hold until publication | | Title: | Structure of the USP11 deubiquitinase domain | | Authors: | Zhao, Z., Gao, Y., An, Y., Lan, H. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z37 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human STING ligand binding domain. | | Authors: | Sun, P.K., Li, X.J. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9be3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-13 |
|
| PDBID: | 9be4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-13 |
|
| PDBID: | 9ezp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-13 |
|
| PDBID: | 9ezn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-13 |
|
| PDBID: | 9ezo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase mutant N253Q from Deinococcus radiodurans | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase mutant N253T from Deinococcus radiodurans | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase mutant R148A from Deinococcus radiodurans | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase from Deinococcus radiodurans complexed with validoxylamine A (VAA) | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase mutamt E324D from Deinococcus radiodurans complexed with validoxylamine A (VAA) | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z1u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 9bdq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bdm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 9bdr | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cardiac amyloid fibril from a variant ATTRV122delta, double filament morphology 1 | | Authors: | Nguyen, B.A., Ahmed, Y., Saelices, L. | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 9bdo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anti-abTCR NANOBODY VHH | | Authors: | Qiu, Y. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bds | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-12 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9bdt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bdk | | Status: | HPUB -- hold until publication | | Title: | CP20.2 Fab in complex with HIV-1 Env BG505 SOSIP.664 and RM20A3 Fab | | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9ezh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-12 |
|
