| PDBID: | 8xgu | | Status: | HPUB -- hold until publication | | Title: | a peptide receptor complex structure | | Authors: | Wu, Z., Du, Y., Chen, G. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgm | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human GPR1 bound to chemerin | | Authors: | Liu, A.J., Liu, Y.Z., Ye, R.D. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Neisseria gonorrhoeae FabI in complex with NADH and (E)-3-((2R,3S)-3-hydroxy-2-methyl-4-oxo-2,3,4,5-tetrahydro-1H-pyrido[2,3-b][1,4]diazepin-8-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide | | Authors: | Ronin, C., Gerusz, V., Ciesielski, F. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 | | Sequence: | >Entity 1
GPGSRTPVELRLTEIFRDVLGHDAFGVLDDFFELGGDSFKAIRIAAKYGPPLEVTDIYDHPTIEALAAHLAR
|
|
| PDBID: | 8rh7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rh8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rha | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rho | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhb | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vdj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vdh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vdl | | Status: | HPUB -- hold until publication | | Title: | HB3VAR03 CIDRa1.4 domain with C7 Fab | | Authors: | Hurlburt, N.K., Pancera, M. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vdk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of LPXTG-motif Cell Wall Anchor Domain Protein MSCRAMM_SdrD from Staphylococcus aureus | | Authors: | Kim, Y., Tan, A., Endres, M., Joachimiak, A., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vdf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human monoclonal antibody C7 targeting IT4VAR22 CIDRa1.7 (PfEMP1 A) | | Authors: | Raghavan, S.S.R., Ward, A.B. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vdg | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human monoclonal antibody C74 targeting IT4VAR22 CIDRa1.7 | | Authors: | Raghavan, S.S.R., Ward, A.B. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vdi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xfx | | Status: | HPUB -- hold until publication | | Title: | Archaeal exosome subcomplex (Rrp41-Rrp42) | | Authors: | Kim, H.S., Park, S.H., Kim, S.H., Hwang, K.Y. | | Deposition date: | 2023-12-14 |
|
