PDBID: | 9av1 | Status: | HPUB -- hold until publication | Title: | Crystal structure of E. coli GuaB dCBS with inhibitor GNE9123 | Authors: | Harris, S.F., Wu, P. | Deposition date: | 2024-03-01 |
|
PDBID: | 9auw | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 9auz | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 9av2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 9av5 | Status: | HPUB -- hold until publication | Title: | Design and application of synthetic 17B-HSD13 substrates to drug discovery, and to reveal preserved catalytic activity of protective human variants | Authors: | Liu, S., Garnsey, M. | Deposition date: | 2024-03-01 |
|
PDBID: | 9av8 | Status: | HPUB -- hold until publication | Title: | Design and application of synthetic 17B-HSD13 substrates to drug discovery, and to reveal preserved catalytic activity of protective human variants | Authors: | Liu, S., Garnsey, M. | Deposition date: | 2024-03-01 |
|
PDBID: | 9avc | Status: | HPUB -- hold until publication | Title: | Fis1 Structure Y38E mutation | Authors: | Mathews, I.I., Pokhrel, S., Wakatsuki, S. | Deposition date: | 2024-03-01 |
|
PDBID: | 8yim | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 |
|
PDBID: | 8yii | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 |
|
PDBID: | 8yic | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-02-29 | Release date: | 2025-02-28 |
|
PDBID: | 8yig | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 |
|
PDBID: | 8yid | Status: | HPUB -- hold until publication | Title: | Imine Reductase from Burkholderia ubonensis in complex with NADH and 6-methyl-2,3,4,5-tetrahydropyridine | Authors: | Ma, Z.F., Shen, X.Y. | Deposition date: | 2024-02-29 | Sequence: | >Entity 1 MAQTVGVIGTGLMGSALVNTLLKAGTKVTVWDGRKEATAGVVANGAKLASSFVELVNGNDVVISIVSSASIGANLFREHVSQLNLDGRYVANLSTAMPEDGEAFRDIIESNGGRFISAAISSYPDLIGGPYTAIQYAGKEEVWRAVEATFKPLAPEGTIYTGANLAVPPIVDAAMTGSFYAVSLAGFLEAAAYAKARGVSPSQLGDFADKMLDLVRYKVHKSIREIEANNFETIQATVDVYLDAVIQWRDALKDVGLRASHIAALADDLTVTRDAGYGSLGFTAQFLTASKVD
|
|
PDBID: | 8yik | Status: | HPUB -- hold until publication | Title: | pP1192R-ATPase-domain | Authors: | Sun, J.Q., Liu, R.L. | Deposition date: | 2024-02-29 |
|
PDBID: | 8yi8 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-29 |
|
PDBID: | 8yi6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 |
|
PDBID: | 8yip | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 |
|
PDBID: | 8yiq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of human proteasome assembly intermediate P-6a0b | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | Deposition date: | 2024-02-29 |
|
PDBID: | 8yir | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of human proteasome assembly intermediate P-7a0b | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | Deposition date: | 2024-02-29 |
|
PDBID: | 8yis | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human proteasome assembly intermediate P-7a2b | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | Deposition date: | 2024-02-29 |
|
PDBID: | 8yit | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of human proteasome assembly intermediate P-7a3b | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | Deposition date: | 2024-02-29 |
|
PDBID: | 8yiu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of human proteasome assembly intermediate P-7a4b | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | Deposition date: | 2024-02-29 |
|
PDBID: | 8yiw | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of human proteasome assembly intermediate P-7a6b | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | Deposition date: | 2024-02-29 |
|
PDBID: | 8yix | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of human proteasome assembly intermediate half-proteasome | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | Deposition date: | 2024-02-29 |
|
PDBID: | 8yiy | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of human proteasome assembly intermediate preholo-1 | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | Deposition date: | 2024-02-29 |
|
PDBID: | 8yj0 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of human proteasome assembly intermediate P-twisted | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | Deposition date: | 2024-02-29 |
|