PDBID: | 9ga9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure hASF1A 156-cr7 | Authors: | Ochsenbein, F.O., Vitard, A.V. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga6 | Status: | AUTH -- processed, waiting for author review and approval | Title: | The crystal structure of human Annexin A4 derived from crystals grown in 40 mM of CaCl2 | Authors: | Vitagliano, L., Barra, G., Ghilardi, O., Di Micco, S., Bifulco, G., Campiglia, P., Sala, M., Scala, M.C., Ruggiero, A. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | The crystal structure of human Annexin A4 derived from crystal grown at 4 mM CaCl2 and retro-soaking | Authors: | Vitagliano, L., Barra, G., Ghilardi, O., Di Micco, S., Scala, M.C., Sala, M., Campiglia, P., Bifulco, G., Ruggiero, A. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | The crystal structure of human Annexin A4 from crystals grown at 4 mM Calcium | Authors: | Ruggiero, A., Barra, G., Ghilardi, O., Scala, M.C., Sala, M., Di Micco, S., Bifulco, G., Campiglia, P., Vitagliano, L. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga2 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | MtUvrA2UvrB bound to damaged oligonucleotide | Authors: | Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga4 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga5 | Status: | AUTH -- processed, waiting for author review and approval | Title: | MtUvrA2 bound to endogenous E. coli DNA | Authors: | Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga0 | Status: | AUTH -- processed, waiting for author review and approval | Title: | XPA crystal grown in HEK293 cell | Authors: | Melicher, F., Isabet, T., Chavas, L.M.G., Montaville, P. | Deposition date: | 2024-07-26 |
|
PDBID: | 9gae | Status: | AUTH -- processed, waiting for author review and approval | Title: | Respiratory supercomplex CI1-CIII2-CIV2 from alphaproteobacterium | Authors: | Yaikhomba, M., Hirst, J., Croll, T.I., Spikes, T.E. | Deposition date: | 2024-07-26 | Release date: | 2025-07-26 |
|
PDBID: | 9iww | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with GSK''872 | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | Deposition date: | 2024-07-26 |
|
PDBID: | 9iwx | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the mouse RIP3 kinase domain(R69H) in complexed with GSK''872 | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | Deposition date: | 2024-07-26 |
|
PDBID: | 9iwy | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with LK01003 | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | Deposition date: | 2024-07-26 |
|
PDBID: | 9iwz | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with GSK''843 | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ix0 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with GW''39B | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ix1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with PP2 | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ix2 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with TAK-632 | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ix3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with compound 18 | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ix9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Mutant H286T Crystal Structure of Two-domain bacterial laccase from the actinobacterium Streptomyces carpinensis VKM Ac-1300 | Authors: | Gabdulkhakov, A.G., Tishchenko, T.V., Trubitsina, L., Trubitsin, I., Leontievsky, A., Lisov, A. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ix8 | Status: | HPUB -- hold until publication | Title: | Crystallization and structural characterization of phosphopentomutase from the hyperthermophilic archaeon Thermococcus kodakarensis | Authors: | Naz, Z., Lubkowski, T.J., Saleem, M., Rahman, M., Wlodawer, A., Rashid, N. | Deposition date: | 2024-07-26 | Sequence: | >Entity 1 RLFGTAGIRGTLWEKVTPELAMKVGMAVGTYKSGKALVGRDGRTSSVMLKNAMISGLLSTGMEVLDADLIPTPALAWGTRKLADAGVMITASHNPPTDNGVKVFNGDGTEFYVEQERGLEEIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVLYDGANGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDLAIAQDGDADRIAVFDEKGNYVDEDTVIALFAKLYVEEHGGGTVVVSIDTGSRIDAVVERAGGRVVRIPLGQPHDGIKRYKAIFAAEPWKLVHPKFGPWIDPFVTMGLLIKLIDENGPLSELVKEIPTYYLKKANVLCPDEYKAEVVRRAAEEVERKLSSEIKEVLTISGFRIALNDGSWILIRPSGTEPKIRVVAEAPTEKRRDELFEMAYSTVSRIVKEAEKK
|
|
PDBID: | 9iwv | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of Lsd18 after incubation with the substrate | Authors: | Wang, Q., Chen, X., Kim, C.Y. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ix4 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-07-26 |
|
PDBID: | 9ix5 | Status: | HPUB -- hold until publication | Title: | An agonist(compound 15n) of Thyroid Hormone Receptor B | Authors: | Yao, B., Li, Y. | Deposition date: | 2024-07-26 |
|
PDBID: | 9iwu | Status: | HPUB -- hold until publication | Title: | CTB10_M40BpA_M86I-R-1d | Authors: | Fu, K., Rao, Y.J. | Deposition date: | 2024-07-26 |
|