PDBID: | 8xr9 | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xra | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xrb | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xrc | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xrd | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xrj | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xrk | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xrl | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xrm | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xrn | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xro | Status: | HOLD -- hold until a certain date | Title: | Crystal Structure of 5-Aminoimidazole Ribonucleotide (AIR) Synthetase from Pyrococcus horikoshii with ATP | Authors: | Chen, Y.H., Chen, C.J. | Deposition date: | 2024-01-07 | Release date: | 2025-01-07 |
|
PDBID: | 8xrq | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 BA.1 spike RBD in complex bound with VacBB-639 | Authors: | Liu, C.C., Ju, B., Zhang, Z. | Deposition date: | 2024-01-08 |
|
PDBID: | 8xrr | Status: | HPUB -- hold until publication | Title: | A complex structure of PDGFRA with an inhibitor RH140 | Authors: | Zhu, S.J., Bi, S.Z. | Deposition date: | 2024-01-08 |
|
PDBID: | 8xrs | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8xrw | Status: | HOLD -- hold until a certain date | Title: | crystal structure of HpPPAT in complex with ATP | Authors: | Yin, H.S. | Deposition date: | 2024-01-08 | Release date: | 2025-01-08 |
|
PDBID: | 8xrz | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8xs1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8xs2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 | Sequence: | >Entity 1 MATGQVKLQQSGAEFVKAGASVKLSCKTSGYTFNNYWIHWVKQSPGQGLEWIGEIDPSDGYSNYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCTSSTSVGGSWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSASAAHHHHHHGAAEQKLISEEDLNGAA
>Entity 2 MSDIELTQSPLSLPVSLGDQASISCTSSQSLLHSNGDTYLHWYLQKPGQSPKLLIYTLSNRFSGVPDRFSGSGSGTDFTLKISRVEAADLGIYFCSQTTHVPYTFGGGTKLEIKRADAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEGGGSDYKDDDDK
|
|
PDBID: | 8xs6 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Tapinarof | Authors: | Diao, X., Shang, Q., Wu, D. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8xs7 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with FICZ | Authors: | Diao, X., Shang, Q., Wu, D. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8xs8 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Benzo[a]pyrene | Authors: | Diao, X., Shang, Q., Wu, D. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8xs9 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with beta-Naphthoflavone | Authors: | Diao, X., Shang, Q., Wu, D. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8xsa | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Indigo | Authors: | Diao, X., Shang, Q., Wu, D. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8xsb | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Indirubin | Authors: | Diao, X., Shang, Q., Wu, D. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8xsc | Status: | HOLD -- hold until a certain date | Title: | PPAT in complex with Ppant | Authors: | Yin, H.S. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|