PDBID: | 8x7c | Status: | HPUB -- hold until publication | Title: | Crystal structure of ZmHSL1A | Authors: | Lin, H.-Y., Dong, J., Yang, G.-F. | Deposition date: | 2023-11-23 |
|
PDBID: | 8x7d | Status: | HPUB -- hold until publication | Title: | Crystal structure of OsHSL1 L204F/F298L/I335F | Authors: | Lin, H.-Y., Dong, J., Yang, G.-F. | Deposition date: | 2023-11-23 |
|
PDBID: | 8x7e | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-24 |
|
PDBID: | 8x7f | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-11-24 |
|
PDBID: | 8x7g | Status: | HPUB -- hold until publication | Title: | Crystal structure of 108 | Authors: | Dong, C., Yan, X., Li, Y. | Deposition date: | 2023-11-24 |
|
PDBID: | 8x7h | Status: | HPUB -- hold until publication | Title: | Crystal structure of 162 | Authors: | Dong, C., Yan, X., Li, Y. | Deposition date: | 2023-11-24 |
|
PDBID: | 8x7l | Status: | HPUB -- hold until publication | Title: | EB-bound E46K alpha-synuclein fibrils | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2023-11-24 |
|
PDBID: | 8x7m | Status: | HPUB -- hold until publication | Title: | CR-bound E46K alpha-synuclein fibrils | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2023-11-24 |
|
PDBID: | 8x7o | Status: | HPUB -- hold until publication | Title: | PiB-bound E46K mutanted alpha-synuclein fibrils | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2023-11-24 |
|
PDBID: | 8x7p | Status: | HPUB -- hold until publication | Title: | CCA-bound E46K alpha-synuclein fibrils | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2023-11-24 |
|
PDBID: | 8x7q | Status: | HPUB -- hold until publication | Title: | pFTAA-bound E46K alpha-synuclein fibrils | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2023-11-24 |
|
PDBID: | 8x7r | Status: | HPUB -- hold until publication | Title: | C05-03-bound E46K alpha-synuclein fibrils | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2023-11-24 |
|
PDBID: | 8x7s | Status: | HPUB -- hold until publication | Title: | Crystal structure of tlr0611 | Authors: | Su, J.Y. | Deposition date: | 2023-11-25 |
|
PDBID: | 8x7v | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-11-26 | Release date: | 2024-11-26 |
|
PDBID: | 8x7w | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-11-26 | Release date: | 2024-11-26 |
|
PDBID: | 8x86 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-27 |
|
PDBID: | 8x89 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Streptococcus pneumoniae fabG | Authors: | Xu, K.M. | Deposition date: | 2023-11-27 | Sequence: | >Entity 1 MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELLAEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEADFEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGFTKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTVFLAGQDYLTGQVIAIDGGLSM
|
|
PDBID: | 8x8a | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-27 |
|
PDBID: | 8x8b | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-27 |
|
PDBID: | 8x8c | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-11-27 |
|
PDBID: | 8x8d | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription initiation complex with four GlnR and two PhoP molecules | Authors: | Lin, W., Shi, J. | Deposition date: | 2023-11-27 |
|
PDBID: | 8x8e | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with two PhoP molecules | Authors: | Lin, W., Shi, J. | Deposition date: | 2023-11-27 |
|
PDBID: | 8x8f | Status: | HPUB -- hold until publication | Title: | Crystal structure of lipoxygenase from Enhygromyxa salina | Authors: | Kim, J.W., Seo, P.W., Kim, J.S. | Deposition date: | 2023-11-27 |
|
PDBID: | 8x8h | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-11-27 | Release date: | 2024-11-27 |
|
PDBID: | 8x8i | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-27 |
|