PDBID: | 8vhj | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhk | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhs | Status: | AUTH -- processed, waiting for author review and approval | Title: | X-ray Structure of a De Novo Designed Self Assembled Peptide Tetramer Featuring a Cu(His)4(H2O) Coordination Motif | Authors: | Chakraborty, S., Mitra, S., Prakash, D., Prasad, P. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vht | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA3 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhv | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhz | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA1 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vi0 | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA6 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vi1 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-02 | Release date: | 2025-01-02 |
|
PDBID: | 8vi7 | Status: | HPUB -- hold until publication | Title: | Bos Taurus Mitochondrial BC1 in complex with Atovaquone | Authors: | Xia, D., Zhou, F., Esser, L. | Deposition date: | 2024-01-03 |
|
PDBID: | 8vi9 | Status: | HPUB -- hold until publication | Title: | NEMO IKK-binding domain with bound small molecule fragment | Authors: | Kennedy, A.E. | Deposition date: | 2024-01-03 | Sequence: | >Entity 1 GSWSVKELEDKNEELLSEIAHLKNEVARLKKLLQRCLAANQELRDAMRQSNQILRERAEELLHFQASQREEKEFLMSKFQEARKLVERLGLEKLELEDKNEELLSEIAHLKNEVARLKKLVGER
|
|
PDBID: | 8via | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-03 |
|
PDBID: | 8vim | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-04 |
|
PDBID: | 8vin | Status: | AUTH -- processed, waiting for author review and approval | Title: | Superfolder Green Fluorescent Protein with 2-cyano-L-phenylalanine at the chromophore (position 66) | Authors: | Kirsh, J.M., Bagheri, N., Boxer, S.G. | Deposition date: | 2024-01-05 |
|
PDBID: | 8vio | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8vip | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8viq | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8vir | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8vit | Status: | HPUB -- hold until publication | Title: | Crystal structure of the N-terminal domain of fatty acid kinase A (FakA) from Staphylococcus aureus (Mg and ADP) | Authors: | Lovell, S., Kashipathy, M.M., Battaile, K.P., Bose, J.L. | Deposition date: | 2024-01-05 |
|
PDBID: | 8viv | Status: | HPUB -- hold until publication | Title: | Crystal structure of FBF-2 RBD in complex with gld-1 FBEa* RNA | Authors: | Qiu, C., Hall, T.M.T. | Deposition date: | 2024-01-05 |
|
PDBID: | 8vix | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8viy | Status: | HPUB -- hold until publication | Title: | 15-Lipoxygenase-2 V427L | Authors: | Gilbert, N.C., Offenbacher, A.R., Ohler, A.R.L. | Deposition date: | 2024-01-05 |
|
PDBID: | 8vj9 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant with the C edge loop from Arrestin2 inserted | Authors: | Chen, Q., Tesmer, J.J.G. | Deposition date: | 2024-01-06 | Release date: | 2025-01-22 |
|
PDBID: | 8vjd | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-01-06 |
|
PDBID: | 8vje | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-01-06 |
|
PDBID: | 8vjf | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-01-06 |
|