PDBID: | 8s41 | Status: | HPUB -- hold until publication | Title: | The structure of the copia retrotransposon icosahedral capsid (T=9) | Authors: | Klumpe, S., Beck, F., Briggs, J.A.G., Beck, M., Plitzko, J.M. | Deposition date: | 2024-02-20 |
|
PDBID: | 8s42 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 80 (1124898) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-02-21 |
|
PDBID: | 8s43 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-21 |
|
PDBID: | 8s44 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4d | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4e | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4f | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 | Sequence: | >Entity 1 MSPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
PDBID: | 8s4h | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4i | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4j | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4k | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4l | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4m | Status: | HPUB -- hold until publication | Title: | Crystal structure of Mycobacterium tuberculosis cytochrome P450 CYP125 in complex with an inhibitor | Authors: | Snee, M., Kavanagh, M., Levy, C. | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4n | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4o | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4p | Status: | HPUB -- hold until publication | Title: | Crystal structure of an Ene-reductase from Penicillium steckii | Authors: | Rozeboom, H.J., Fraaije, M.W. | Deposition date: | 2024-02-22 |
|
PDBID: | 8s4q | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-22 |
|
PDBID: | 8s4r | Status: | AUTH -- processed, waiting for author review and approval | Title: | PAO1 uL6-mutant ribosome (G93_A96del) with Tobramycin, LTc4 conformation | Authors: | Mesa, P., Montoya, G. | Deposition date: | 2024-02-22 |
|
PDBID: | 8s4u | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-22 |
|
PDBID: | 8s4v | Status: | HPUB -- hold until publication | Title: | Tankyrase 2 in complex with a quinazolin-4-one inhibitor | Authors: | Bosetti, C., Lehtio, L. | Deposition date: | 2024-02-22 |
|
PDBID: | 8s4w | Status: | HPUB -- hold until publication | Title: | Tankyrase 2 in complex with a quinazolin-4-one inhibitor | Authors: | Bosetti, C., Lehtio, L. | Deposition date: | 2024-02-22 |
|
PDBID: | 8s4x | Status: | HPUB -- hold until publication | Title: | Tankyrase 2 in complex with a quinazolin-4-one inhibitor | Authors: | Bosetti, C., Lehtio, L. | Deposition date: | 2024-02-22 |
|
PDBID: | 8s4y | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-22 |
|
PDBID: | 8s4z | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-22 |
|
PDBID: | 8s50 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-22 |
|