PDBID: | 8kc0 | Status: | HPUB -- hold until publication | Title: | De novo design protein -NB8 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-05 |
|
PDBID: | 8kc1 | Status: | HPUB -- hold until publication | Title: | De novo design protein -NX5 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-05 |
|
PDBID: | 8kc3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-05 |
|
PDBID: | 8kc4 | Status: | HPUB -- hold until publication | Title: | De novo design protein -NA05 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-06 |
|
PDBID: | 8kc5 | Status: | HPUB -- hold until publication | Title: | De novo design protein -T09 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-06 |
|
PDBID: | 8kc8 | Status: | HPUB -- hold until publication | Title: | De novo design protein -T11 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-06 |
|
PDBID: | 8kc9 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-06 | Release date: | 2025-02-06 |
|
PDBID: | 8kcd | Status: | HPUB -- hold until publication | Title: | Complex of DDM1-nucleosome(H2A.W) complex with DDM1 bound to SHL2 and SHL-2 | Authors: | Zhang, H., Zhang, Y. | Deposition date: | 2023-08-07 |
|
PDBID: | 8kce | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-07 |
|
PDBID: | 8kcg | Status: | AUTH -- processed, waiting for author review and approval | Title: | Sus scrofa complex I close state 3 from supercomplex I+III2+IV in the presence of proguanil | Authors: | Teng, F., Hu, Y.Q., Zhou, L. | Deposition date: | 2023-08-07 |
|
PDBID: | 8kch | Status: | AUTH -- processed, waiting for author review and approval | Title: | Sus scrofa complex I close state 2 from supercomplex I+III2+IV in the presence of proguanil | Authors: | Teng, F., Hu, Y.Q., Zhou, L. | Deposition date: | 2023-08-07 |
|
PDBID: | 8kcj | Status: | HPUB -- hold until publication | Title: | De novo design protein -N7 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-07 |
|
PDBID: | 8kck | Status: | HPUB -- hold until publication | Title: | De novo design protein -N9 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-07 | Sequence: | >Entity 1 GAEAAAAAAVTAELRAFRAAGGTVELEDLPVTPETLARAEAALARLPPESVAVETYTVPAPTPEAFLAALEAALARLAAEGLPAILLRVVDADGNLVGSILVAAAGPPAESAAATGRVLTIYVASSPEGLKVARGLAIETRDAGGLALAIGASGAWALAGLAGALALARRLAEAHGAPVRVVTIGDPANPTDAALAAAIRAAYAAALEHHHHHH
|
|
PDBID: | 8kcn | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-08 |
|
PDBID: | 8kco | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcp | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcr | Status: | HPUB -- hold until publication | Title: | Crystal Structure of E447A Acyl-CoA Dehydrogenase FadE15 mutant from Mycobacteria tuberculosis in complex with C18CoA | Authors: | Liu, X., Chen, R., Ma, M. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcs | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human gamma-secretase in complex with BMS906024 | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kct | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human gamma-secretase in complex with Nirogacestat | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcu | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human gamma-secretase in complex with MK-0752 | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcv | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of UDA01-CAAMDDFQL | Authors: | Tang, Z., Zhang, N. | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8kcy | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2025-02-08 |
|
PDBID: | 8kd0 | Status: | HPUB -- hold until publication | Title: | Crystal structure of SAR11_0769 from ''Candidatus Pelagibacter ubique'' HTCC1062 bound to a co-purified ligand, beta-galactopyranose | Authors: | Clifton, B.E., Laurino, P. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kd1 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2025-02-08 |
|
PDBID: | 8kd8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|