PDBID: | 8xz5 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-20 | Release date: | 2025-01-20 |
|
PDBID: | 8xz6 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-20 | Release date: | 2025-01-20 |
|
PDBID: | 8xz8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | BA.2.86 Spike in complex with bovine ACE2 (bound 1 ACE2) | Authors: | Yue, C., Liu, P. | Deposition date: | 2024-01-21 |
|
PDBID: | 8xz9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | BA.2.86 Spike in complex with bovine ACE2 (bound 2 ACE2) | Authors: | Yue, C., Liu, P. | Deposition date: | 2024-01-21 |
|
PDBID: | 8xza | Status: | HPUB -- hold until publication | Title: | BA.2.86 Spike in complex with bovine ACE2 (Local refinement) | Authors: | Yue, C., Liu, P. | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzc | Status: | HPUB -- hold until publication | Title: | Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (PM20D2) Tyr314Phe mutant | Authors: | Chandravanshi, K., Kumar, A., Makde, R.D. | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzs | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzt | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzu | Status: | HPUB -- hold until publication | Title: | HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 2.33 angstrom resolution | Authors: | Manjunath, K., Goswami, A. | Deposition date: | 2024-01-21 | Sequence: | >Entity 1 MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
PDBID: | 8xzv | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzx | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzy | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzz | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8y00 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8y01 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of Medium-wave-sensitive opsin 1 | Authors: | Peng, Q., Jiang, H.H., Cheng, X.Y., Li, J., Zhang, J. | Deposition date: | 2024-01-21 | Release date: | 2025-01-21 |
|
PDBID: | 8y02 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of Short-wave-sensitive opsin 1 | Authors: | Peng, Q., Jiang, H.H., Cheng, X.Y., Li, J., Zhang, J. | Deposition date: | 2024-01-21 | Release date: | 2025-01-21 |
|
PDBID: | 8y03 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y04 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y05 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y06 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y07 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y08 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y09 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y0a | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y0b | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|