| PDBID: | 8wta | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8wti | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the SARS-CoV-2 main protease in complex with 20j | | Authors: | Zeng, R., Zhao, X., Yang, S.Y., Lei, J. | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8wtl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Cas3-DExD+MG+ATP | | Authors: | Mo, X. | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8wtm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8wtn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8wto | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8wtp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8wts | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 3CLpro bound to covalent inhibitor | | Authors: | Peng, J., Sun, D., Ding, X. | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8wtt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8wu0 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of lisargine | | Authors: | Wang, P., Zhu, Z. | | Deposition date: | 2023-10-19 | | Release date: | 2024-10-19 |
|
| PDBID: | 8wu9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human canonical nucleosome | | Authors: | Liu, X., Gong, Q.Y. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wub | | Status: | HPUB -- hold until publication | | Title: | The X-ray structure of human neuroglobin C120S mutant | | Authors: | Lin, Y.W., Yuan, H. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wuh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of A. thaliana canonical H2A.13 nucleosome | | Authors: | Liu, X., Gong, Q.Y. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wuj | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of A. thaliana H2A.W nucleosome | | Authors: | Liu, X., Gong, Q.Y. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wup | | Status: | HPUB -- hold until publication | | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A wild-type | | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wur | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SARS-Cov-2 main protease D48N mutant in complex with shikonin | | Authors: | Zhao, Z.Y., Li, W.W., Zhang, J., Li, J. | | Deposition date: | 2023-10-21 | | Release date: | 2024-10-21 |
|
| PDBID: | 8wuz | | Status: | HPUB -- hold until publication | | Title: | Development of 2-imino-2,3,5,6,7,8-hexahydropyrido[4,3-d]pyrimidin-4(1H)-one derivatives as human caseinolytic peptidase P (hClpP) activators | | Authors: | Jiang, J.-X., Ding, H., Chen, M.-R., Lu, M.-L., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv0 | | Status: | HPUB -- hold until publication | | Title: | Outer membrane porin of Burkholderia pseudomallei (BpsOmp38) | | Authors: | Bunkum, P., Aunkham, A., Bert van den, B., Robinson, R.C., Suginta, W. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv1 | | Status: | HPUB -- hold until publication | | Title: | Ambient Temperature Structure of 50S Ribosomal Subunit from Thermus Thermophilus | | Authors: | DeMirci, H., Tosun, B. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 | | Sequence: | >Entity 1
MLTDNWKELAGKAQSTFQKSLKQAIELADFDEGLAKRYGALPSAIGANVEDFGSPAQFPLEEYLKALPKKVLDITEKDPVELLKDLKSRKVTCVEVLKAYTAASIVASKLTNCVQEFLPIEALQYAQKLDADYETKKHLPLYGLPFSIKEMIPFVGRSVTHGSLCYLDRIVDYNADIVNILIANGAYPFVRTTNPQSLMMLECVSFSHGRTVNAYNGMLTSGGSSGGEGALNGMRASPFGLGSDIGGSIRCPAAFNGIYGLRSTLGRIPTADYFSCNRGSESILSVTGPLSRSLDTVNLVMKTVIEAKPWLIDPTLVPLDWKRPENKKFRVGIYVSDHIVNPSPPINRALSMVTEKLKSLGNFEVVTFEPYKPEKVTEILGKLYFEDGARDFRATLQTGEPLLEQTRWAIEGAEDLDMHDQWYWNLQKQAYRKEFLKHWCSYTDNDGNVLDAVIAPVFPNVAAKHETTKYWTYTSQWNLLDYPVLAFPVTKVDESLDQPYKNYKPLNDLDKYFYEQYDSPSSFKNAPANLCLVGLRFTDEKLVEIANILRN
|
|
| PDBID: | 8wv3 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-23 | | Release date: | 2024-10-23 |
|
| PDBID: | 8wv7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wv9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wva | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wvc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
