PDBID: | 8vj8 | Status: | HPUB -- hold until publication | Title: | X-ray Counterpart to Neutron Structure of Reduced Trp161Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-01-05 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 8vj9 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant with the C edge loop from Arrestin2 inserted | Authors: | Chen, Q., Tesmer, J.J.G. | Deposition date: | 2024-01-06 | Release date: | 2025-01-22 |
|
PDBID: | 8vja | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM of tail of bacteriophage Chi | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | Deposition date: | 2024-01-06 | Release date: | 2025-01-06 |
|
PDBID: | 8vjd | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-01-06 |
|
PDBID: | 8vje | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-01-06 |
|
PDBID: | 8vjf | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-01-06 |
|
PDBID: | 8vjg | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-01-06 |
|
PDBID: | 8vjh | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM of tail-tip of bacteriophage Chi | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | Deposition date: | 2024-01-06 | Release date: | 2025-01-06 |
|
PDBID: | 8vji | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM of capsid of bacteriophage Chi | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | Deposition date: | 2024-01-06 | Release date: | 2025-01-06 |
|
PDBID: | 8vjl | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8vjm | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8vjq | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8vjt | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vju | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vjv | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vjw | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-08 |
|
PDBID: | 8vjx | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vjy | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vjz | Status: | HPUB -- hold until publication | Title: | HLA-A*03:01 with WT KRAS-10mer | Authors: | Sim, M.J.W., Sun, P.D. | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk6 | Status: | HPUB -- hold until publication | Title: | Amide-linked, extended 14alpha-demethylase (CYP51) with antifungal azole inhibitor | Authors: | Tyndall, J.D.A., Monk, B.C., Simons, C. | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|