PDBID: | 8uz2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-14 |
|
PDBID: | 8uz3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-14 |
|
PDBID: | 8uz9 | Status: | HPUB -- hold until publication | Title: | Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular Host | Authors: | Rupert, P.B., Strong, R.K. | Deposition date: | 2023-11-14 | Sequence: | >Entity 1 QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
|
|
PDBID: | 8uzc | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Structure of UT14 Fab in complex with the head domain of H3 (A/Singapore/INFIMH-16-0019/2016) | Authors: | Park, J., Georgiou, G. | Deposition date: | 2023-11-14 |
|
PDBID: | 8uze | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-15 |
|
PDBID: | 8uzf | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-15 |
|
PDBID: | 8uzg | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-11-15 |
|
PDBID: | 8uzl | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-15 |
|
PDBID: | 8uzp | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the Computationally Designed Influenza Hemagglutinin Epitope Scaffold stem_mimetic_01 bound by Antibody CR9501 | Authors: | Harshbarger, W., Malito, E. | Deposition date: | 2023-11-16 |
|
PDBID: | 8uzq | Status: | HPUB -- hold until publication | Title: | RNA polymerase II elongation complex with 8-oxoguanine in +1 active site | Authors: | Oh, J., Wang, D. | Deposition date: | 2023-11-16 |
|
PDBID: | 8uzr | Status: | HPUB -- hold until publication | Title: | RNA polymerase II elongation complex with 8-oxoguanine with bound CMPCPP | Authors: | Oh, J., Wang, D. | Deposition date: | 2023-11-16 |
|
PDBID: | 8uzs | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | RNA polymerase II elongation complex with 8-oxoguanine with 3'' CTP added | Authors: | Oh, J., Wang, D. | Deposition date: | 2023-11-16 |
|
PDBID: | 8uzt | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-16 |
|
PDBID: | 8uzv | Status: | HPUB -- hold until publication | Title: | Structure of TDP1 catalytic domain complexed with compound IB02 | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | Deposition date: | 2023-11-16 |
|
PDBID: | 8uzz | Status: | HPUB -- hold until publication | Title: | Structure of TDP1 catalytic domain complexed with compound IB03 | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | Deposition date: | 2023-11-16 |
|
PDBID: | 8v03 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-16 |
|
PDBID: | 8v09 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-17 |
|
PDBID: | 8v0a | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the worst case of the reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood with PGH | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | Deposition date: | 2023-11-17 |
|
PDBID: | 8v0b | Status: | HPUB -- hold until publication | Title: | Structure of TDP1 catalytic domain complexed with compound IB05 | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | Deposition date: | 2023-11-17 |
|
PDBID: | 8v0c | Status: | HPUB -- hold until publication | Title: | Structure of TDP1 catalytic domain complexed with compound IB06 | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | Deposition date: | 2023-11-17 |
|
PDBID: | 8v0d | Status: | HPUB -- hold until publication | Title: | Ubch5B-RING3 of MIB1 fusion structure | Authors: | Cao, R., Blacklow, S.C. | Deposition date: | 2023-11-17 |
|
PDBID: | 8v0e | Status: | HPUB -- hold until publication | Title: | ANK repeat of MIB1 | Authors: | Cao, R., Blacklow, S.C. | Deposition date: | 2023-11-17 |
|
PDBID: | 8v0g | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-17 |
|
PDBID: | 8v0h | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-17 |
|
PDBID: | 8v0j | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-11-17 |
|