| PDBID: | 8uxt | | Status: | HPUB -- hold until publication | | Title: | Acinetobacter baumannii Tse15 Rhs effector, toxin cleavage mutant (D1369N, D1391N) | | Authors: | Hayes, B.K., Venugopal, H., McGowan, S. | | Deposition date: | 2023-11-10 |
|
| PDBID: | 8uxv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-11 |
|
| PDBID: | 8uxy | | Status: | HPUB -- hold until publication | | Title: | Consensus olfactory receptor consOR1 bound to L-menthol and in complex with mini-Gs trimeric protein | | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | | Deposition date: | 2023-11-11 |
|
| PDBID: | 8uxz | | Status: | HPUB -- hold until publication | | Title: | Structure of E. coli acetyl-CoA carboxylase (local reconstruction of the wide helical tube at 3.31 Angstrom resolution) | | Authors: | Xu, X., Silva de Sousa, A., Boram, T.J., Jiang, W., Lohman, R.J. | | Deposition date: | 2023-11-11 |
|
| PDBID: | 8uy0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-11 |
|
| PDBID: | 8uy3 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Fem1B with FNIP1 and Tom20 fragment | | Authors: | Gee, C.L., Manford, A.G., McMinimy, R., Rape, M. | | Deposition date: | 2023-11-12 | | Release date: | 2024-11-12 |
|
| PDBID: | 8uy4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy5 | | Status: | HPUB -- hold until publication | | Title: | [ZP] Self-assembling DNA crystal with expanded genetic code using C,A,T,G, Z and P nucleotides | | Authors: | Vecchioni, S., Sha, R., Ohayon, Y.P., Hernandez, C. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy6 | | Status: | HPUB -- hold until publication | | Title: | Aquaporin Z with ALFA tag and bound to nanobody | | Authors: | Stover, L., Bahramimoghaddam, H., Wang, L., Zhou, M., Laganowsky, A. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uya | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uyb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uyn | | Status: | HPUB -- hold until publication | | Title: | Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular Host | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2023-11-13 | | Sequence: | >Entity 1
QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
|
|
| PDBID: | 8uyq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Consensus olfactory receptor consOR4 bound to 2-methylthiazoline and in complex with mini-Gs trimeric protein | | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uyr | | Status: | HPUB -- hold until publication | | Title: | Manganese-substituted DitZ from Rhodococcus Rhodochrous | | Authors: | Liu, C., Chen, S., Rittle, J. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uyt | | Status: | HPUB -- hold until publication | | Title: | HBV T=4 capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRG
|
|
| PDBID: | 8uyu | | Status: | HPUB -- hold until publication | | Title: | HBV T=4 capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 8uyv | | Status: | HPUB -- hold until publication | | Title: | HBV T=4 3A mutant capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRAPRRRTPAPRRRRSQAPRRRRSQSREPQC
|
|
| PDBID: | 8uyw | | Status: | HPUB -- hold until publication | | Title: | HBV T=3 3A mutant capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRAPRRRTPAPRRRRSQAPRRRRSQSREPQC
|
|
| PDBID: | 8uyx | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (Wild-type control) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTL
|
|
| PDBID: | 8uyy | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (Preassembled capsid incubated with triton X-100) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 8uyz | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (HBV dimer co-assembled with triton X-100) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
