PDBID: | 8rw7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 | Sequence: | >Entity 1 QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSDINSSGTTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCATEGKYGRTWYGQLEYHYWGQGTQVTVSEHHHHHH
>Entity 2 MHHHHHHESAKAVTTQKVEVKFSKAVEKLTKEDIKVTNKANNDKVLVKEVTLSEDKKSATVELYSNLAAKQTYTVDVNKVGKTEVAVGSLEAKTIEMADQTVVADEPTALQFTVKDENGTEVVSPEGIEFVTPAAEKINAKGEITLAKGTSTTVKAVYKKDGKVVAESKEVKVSAE
|
|
PDBID: | 8rwb | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rwc | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rwd | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-03 |
|
PDBID: | 8rwe | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-03 |
|
PDBID: | 8rwf | Status: | HPUB -- hold until publication | Title: | Domains 1 and 2 of Bacillus anthracis Sap S-layer in complex with Nb692 | Authors: | Sogues, A., Remaut, H. | Deposition date: | 2024-02-04 |
|
PDBID: | 8rwg | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-04 |
|
PDBID: | 8rwh | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-04 |
|
PDBID: | 8rwi | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-05 |
|
PDBID: | 8rwn | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-05 |
|
PDBID: | 8rwo | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-05 |
|
PDBID: | 8rwp | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-05 |
|
PDBID: | 8rwq | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-05 |
|
PDBID: | 8rwr | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-05 |
|
PDBID: | 8rws | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-05 |
|
PDBID: | 8rwt | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-05 |
|
PDBID: | 8rwv | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-05 |
|
PDBID: | 8rwx | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-05 |
|
PDBID: | 8rx1 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-06 |
|
PDBID: | 8rx2 | Status: | HPUB -- hold until publication | Title: | Domains 1 and 2 of Sap S-layer protein from Bacillus anthracis | Authors: | Sogues, A., Remaut, H. | Deposition date: | 2024-02-06 |
|
PDBID: | 8rx4 | Status: | HPUB -- hold until publication | Title: | Mycothione reductase from Mycobacterium xenopi in complex with co-factor FAD and redox co-factor NADP(H) | Authors: | Oorts, L., Osipov, E.M., Beelen, S., Strelkov, S.V. | Deposition date: | 2024-02-06 |
|
PDBID: | 8rx5 | Status: | HPUB -- hold until publication | Title: | Mycothione reductase from M. tuberculosis with FAD and NADPH | Authors: | Oorts, L., Osipov, E.M., Beelen, S., Strelkov, S.V. | Deposition date: | 2024-02-06 |
|
PDBID: | 8rx6 | Status: | HPUB -- hold until publication | Title: | Mycothione reductase from Mycobacterium tuberculosis in complex with Respiri-1093 | Authors: | Oorts, L., Osipov, E.M., Beelen, S., Strelkov, S.V. | Deposition date: | 2024-02-06 |
|