| PDBID: | 8rsl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rsm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rsn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rso | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rss | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 | | Sequence: | >Entity 1
MEELTYRLFMVATVGMLAGTVFLLASSREVKPEHRRGVYISALVCGIAWYHYQKMGASWESGSYDTGLRYVDWVLTVPLMFVEVLAVTRKGAAYNEAVRNWGIAATVMIGAGYYGETSAAGSNEYWTGFVIAMATYVWLMRNLQAEGEGLKGDQAVAFENIKNLILVGWIIYPLGYIAPVVGDFDAIREVLYTIADIIN(LYR)VGLGVLVLQMARVQSGEKVS
|
|
| PDBID: | 8rst | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsw | | Status: | HOLD -- hold until a certain date | | Title: | Solution NMR structure of Pacsin 2 SH3 domain | | Authors: | Tossavainen, H., Permi, P. | | Deposition date: | 2024-01-25 | | Release date: | 2024-02-22 |
|
| PDBID: | 8rsx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsy | | Status: | HPUB -- hold until publication | | Title: | TRYPTOPHAN SYNTHASE measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Sung, S., Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., von Stetten, D., Mehrabi, P., Wilmanns, M., Schulz, E.C. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsz | | Status: | HPUB -- hold until publication | | Title: | TRYPTOPHAN SYNTHASE measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Sung, S., Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., von Stetten, D., Mehrabi, P., Schulz, E.C., Wilmanns, M. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rt0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BTV-15 VP5 pH 6.0 | | Authors: | Stuart, D.I., Sutton, G.C. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rt1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BTV15 VP5 at pH 9.0 | | Authors: | Sutton, G.C., Stuart, D.I. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rtc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rte | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rtf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Trypanosoma congolense pyruvate kinase in complex with a single-domain antibody (TcoPYK-sdAb42) | | Authors: | Sterckx, Y.G.-J. | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8rtg | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8rti | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8rtj | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of lysozyme obtained upon reaction with [VIVO(8-HQ)2] in ethylene glycol | | Authors: | Paolillo, M., Ferraro, G., Merlino, A. | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8rtk | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of lysozyme obtained upon reaction with [VIVO(8-HQ)2] in sodium formate | | Authors: | Paolillo, M., Ferraro, G., Merlino, A. | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8rtl | | Status: | HPUB -- hold until publication | | Title: | Af Aio C65F-C80G | | Authors: | Engrola, F., Romao, M.J., Correia, M., Santos-Silva, T. | | Deposition date: | 2024-01-26 |
|
